DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbo and AT5G02980

DIOPT Version :9

Sequence 1:NP_524989.2 Gene:dbo / 53556 FlyBaseID:FBgn0040230 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_195918.1 Gene:AT5G02980 / 831482 AraportID:AT5G02980 Length:335 Species:Arabidopsis thaliana


Alignment Length:295 Identity:64/295 - (21%)
Similarity:100/295 - (33%) Gaps:95/295 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 QSYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKW 444
            ||.:.|.|.|               :.|:.:|..  :.|||.        ||| :.:.:|| .:|
plant    45 QSLIASRELY---------------ATRSRIGKT--ERFLYI--------CLN-LTKSNPK-YRW 82

  Fly   445 SKVAPMTTRR--LGV----------AVAVLGGFLYAIGGSDGQCPLNTVERYDPRHNKWVAVSPM 497
            ..:.|:...:  |.|          .|:.....:|.|||............:|.|.::...:..|
plant    83 FTLPPVPNEQKLLPVPLFTYHLNSSTVSSTDSEIYIIGGLVWGNRSKKASIFDCRSHQTRRLPKM 147

  Fly   498 STRRKHLGCAVFNNYIYAVGGRDDCMELSSAERYNPLTNTW--SPIVAMTSR------RSGVGLA 554
            ...|......|.:..||.:||.:     ...|.|:|.|.||  :|:...|..      :.||.:.
plant   148 RFPRASAAAHVIDGKIYVIGGGE-----IRGEVYDPTTQTWLTTPVDHTTEECQKVYDKHGVNIC 207

  Fly   555 ------------VVNGQLY------------AVGGFDGSAYLKTIEVYDPE------TNQWR--- 586
                        |.||:||            .|.|.:...:...:...|..      |..|:   
plant   208 FVEIDNLLCQTFVFNGKLYWRHPRGDDFGWARVKGVEQELFRNHLSYVDKSGGGRRVTVWWKSVV 272

  Fly   587 LCGCMNYRRLGGGVGVMRAPQTENYMWC-ENSFKQ 620
            :.||.       |:|......||  :|| |.||::
plant   273 VFGCQ-------GLGYSTEFDTE--IWCAEISFER 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dboNP_524989.2 BTB_POZ_KLHL20_KLEIP 49..176 CDD:349558
PHA03098 69..587 CDD:222983 53/259 (20%)
KELCH repeat 359..403 CDD:276965 5/22 (23%)
KELCH repeat 407..451 CDD:276965 12/43 (28%)
KELCH repeat 454..497 CDD:276965 9/54 (17%)
KELCH repeat 501..545 CDD:276965 13/45 (29%)
KELCH repeat 548..593 CDD:276965 14/77 (18%)
AT5G02980NP_195918.1 F-box 13..59 CDD:279040 6/28 (21%)
KELCH repeat 99..148 CDD:276965 7/48 (15%)
Kelch 116..161 CDD:128874 9/44 (20%)
Kelch_1 150..183 CDD:279660 10/37 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.