DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbo and AT5G03010

DIOPT Version :9

Sequence 1:NP_524989.2 Gene:dbo / 53556 FlyBaseID:FBgn0040230 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_195921.2 Gene:AT5G03010 / 831473 AraportID:AT5G03010 Length:232 Species:Arabidopsis thaliana


Alignment Length:248 Identity:55/248 - (22%)
Similarity:92/248 - (37%) Gaps:74/248 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 PLMQGPRTRPRKPTRRGEVLFAVGGWCSGDAIASVERFDPQTNDWKMVAPMSKRRCGVGVAVLND 369
            |.|:.||..|....:.| ::..:||..|.:.....|.:|.:||.|..:...|             
plant    31 PKMRQPRASPAAYVKDG-LIIVIGGCRSKNIETWGEIYDLKTNTWGRILLQS------------- 81

  Fly   370 LLYAVGGHD---GQSYLNSIERYDP--QTNQWSCDV-APTTSCRTSVGVAVLDGFLYAVGGQDGV 428
                   ||   ..:|||   |:.|  |||  :|.| ....||.    :.:.||.|:....:.|.
plant    82 -------HDPTVQNAYLN---RFKPNLQTN--ACYVEIDKVSCL----IFLSDGKLFWRETKQGF 130

  Fly   429 QCLNHVERYDPKENKWSKVAPMTTRRLGVAVAVLGG-----------FLYAIGGSD-GQCPLNTV 481
            :..:.:...|.:.:.:..|:        ||.|..||           .|..:.|:: .:|..|  
plant   131 ERCSVILGDDEQVSSYQLVS--------VANAAGGGRVTVWWKSGLKVLDLLSGTETWECYTN-- 185

  Fly   482 ERYDPRHNKWVAVSPMSTRRKHL----GCAVFNNYIYAVGGRDDCME--LSSA 528
                      :..:.:|..|:.|    |...::..::.|.|.||..:  |:||
plant   186 ----------IRCAEISFERRGLRELWGFVEWSREVFTVDGYDDTYDFFLNSA 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dboNP_524989.2 BTB_POZ_KLHL20_KLEIP 49..176 CDD:349558
PHA03098 69..587 CDD:222983 55/248 (22%)
KELCH repeat 359..403 CDD:276965 12/49 (24%)
KELCH repeat 407..451 CDD:276965 6/43 (14%)
KELCH repeat 454..497 CDD:276965 9/54 (17%)
KELCH repeat 501..545 CDD:276965 10/34 (29%)
KELCH repeat 548..593 CDD:276965
AT5G03010NP_195921.2 Kelch_1 36..74 CDD:279660 11/38 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.