DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbo and AT4G39290

DIOPT Version :9

Sequence 1:NP_524989.2 Gene:dbo / 53556 FlyBaseID:FBgn0040230 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_195640.1 Gene:AT4G39290 / 830085 AraportID:AT4G39290 Length:365 Species:Arabidopsis thaliana


Alignment Length:305 Identity:65/305 - (21%)
Similarity:103/305 - (33%) Gaps:111/305 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 KMVAPMSK------RRCGVGVAVLNDLLYAVGGHD-GQSYLNSIERYDPQTNQW----SCDVA-- 401
            |::.|:|.      .|.|| |||.:| :||:||.: ..|..:.:...|.:::.|    |..||  
plant    94 KILVPISSLDSPFDYRSGV-VAVGSD-IYAIGGRNLNNSASSKVMVMDCRSHTWREAPSMRVARD 156

  Fly   402 --PTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSKVAPMTTRRLGVAVAVLGG 464
              |:|        .||:|.:|.:||...:...|.:|.:|.|...|..:......       |..|
plant   157 DFPST--------CVLNGKIYVIGGCKNLDSTNWIEVFDTKTQTWEFLQIPNEE-------VCRG 206

  Fly   465 FLYAIGGSDGQCPLNTVER-------YDPRHNKWVAVSPMSTRRKHLGCA------------VFN 510
            |.|.|.|......::::|.       |:....:|        |..||..:            ||.
plant   207 FNYKIVGYKEAIHVSSLENNRATFMTYEIHKGRW--------REPHLSLSHGFHFSNCVIENVFY 263

  Fly   511 NYIYAVGGRDDCMELSSAERYNPLTNTWSPIVAMTSRRS-----GVGLAVVNGQLYAVGGFDGSA 570
            .|.|.:           .:.|:.....|..:.... |||     |.|:.:||        :.|:.
plant   264 RYSYEM-----------LQWYDSCRKIWKNLKGFV-RRSIMNPRGEGVKMVN--------YGGNI 308

  Fly   571 YLKTIEVYDPETNQWRLCGCMNYRRLGGGVGVMRAPQTENYMWCE 615
            .|           .|..|..:.                :..:|||
plant   309 VL-----------LWEECVTIK----------------KKLIWCE 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dboNP_524989.2 BTB_POZ_KLHL20_KLEIP 49..176 CDD:349558
PHA03098 69..587 CDD:222983 61/275 (22%)
KELCH repeat 359..403 CDD:276965 17/52 (33%)
KELCH repeat 407..451 CDD:276965 11/43 (26%)
KELCH repeat 454..497 CDD:276965 9/49 (18%)
KELCH repeat 501..545 CDD:276965 8/55 (15%)
KELCH repeat 548..593 CDD:276965 10/49 (20%)
AT4G39290NP_195640.1 F-box 11..52 CDD:395521
PHA03098 <89..286 CDD:222983 51/227 (22%)
KELCH repeat 108..151 CDD:276965 14/44 (32%)
KELCH repeat 155..196 CDD:276965 13/48 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.