DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbo and AT4G34170

DIOPT Version :9

Sequence 1:NP_524989.2 Gene:dbo / 53556 FlyBaseID:FBgn0040230 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_195143.1 Gene:AT4G34170 / 829565 AraportID:AT4G34170 Length:293 Species:Arabidopsis thaliana


Alignment Length:237 Identity:55/237 - (23%)
Similarity:86/237 - (36%) Gaps:60/237 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 SYLNSIERYDPQT----------NQWSCD------VAPTTSCRTSVGVAVLDGFLYAVGGQDGVQ 429
            |.|.|:|.|..:|          .|:|..      ::|.:   ||.|:||:...:.|:||.....
plant    44 SLLASVELYQTRTLLGRTERCFYRQYSSRKILVQILSPNS---TSAGIAVVGPNIDAIGGGIKSN 105

  Fly   430 CLNHVERYDPKENKWSKVAPMTTRRLGVAVAVLGGFLYAIGGSDGQCPLNTVERYDPRHNKWVAV 494
            .|:.|...|.:.:.|.:...|...|:..:|..|.|.:|.:||.|.....|.:|.:|.:...|..:
plant   106 TLSSVMVMDSRSHTWREAPSMRVPRMFPSVCTLDGKIYVMGGCDNLDSTNWMEVFDTKTQTWEFL 170

  Fly   495 SPMSTRRKHLGCAVFNNYIYAVGGRDDCMELSSAERYNPLTNTWSPIVAMT-----SRRSGVGLA 554
            ...|..       :|....|            .:.||......||....:|     .|.|...::
plant   171 QIPSEE-------IFGGSAY------------ESVRYEGTVYVWSEKKDVTYKLHEGRWSAADMS 216

  Fly   555 VVNGQLYAVGGFDGSAY-----------LKTIEVYDPETNQW 585
             .||     .|:.||:|           :..|..|||:...|
plant   217 -ANG-----WGWPGSSYCVIENVLYSCFVHKIRWYDPKERVW 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dboNP_524989.2 BTB_POZ_KLHL20_KLEIP 49..176 CDD:349558
PHA03098 69..587 CDD:222983 55/237 (23%)
KELCH repeat 359..403 CDD:276965 8/37 (22%)
KELCH repeat 407..451 CDD:276965 12/43 (28%)
KELCH repeat 454..497 CDD:276965 12/42 (29%)
KELCH repeat 501..545 CDD:276965 6/43 (14%)
KELCH repeat 548..593 CDD:276965 12/49 (24%)
AT4G34170NP_195143.1 F-box 11..55 CDD:279040 5/10 (50%)
KELCH repeat 85..126 CDD:276965 11/40 (28%)
Kelch 97..140 CDD:128874 11/42 (26%)
Kelch_1 129..170 CDD:279660 12/40 (30%)
KELCH repeat 130..170 CDD:276965 12/39 (31%)
KELCH repeat 219..260 CDD:276965 10/39 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.