DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbo and AT4G19250

DIOPT Version :9

Sequence 1:NP_524989.2 Gene:dbo / 53556 FlyBaseID:FBgn0040230 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_193660.1 Gene:AT4G19250 / 827665 AraportID:AT4G19250 Length:228 Species:Arabidopsis thaliana


Alignment Length:261 Identity:50/261 - (19%)
Similarity:74/261 - (28%) Gaps:112/261 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 PQTNQWSCD-------VAPTTS-CRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKW--- 444
            |.|:.|..|       .||:.. .||:....||||.||.:||.:..:..:..|.:|||...|   
plant     3 PSTDVWVYDKLIGKQRKAPSMMVARTNAFTCVLDGKLYVMGGCEADESTHWAEVFDPKTQTWEAL 67

  Fly   445 ---------SKVAPMTTRRLGVAVAVLGGFLYAIGGSDGQCPLNTVERYDPRHNKWVAVSPMSTR 500
                     |.|..:.|::         |.:|.                  |.||          
plant    68 PDPGVELRYSSVKNIQTKQ---------GKVYV------------------RSNK---------- 95

  Fly   501 RKHLGCAVFNNYIYAVGGRDDCMELSSAERYNPLTNTWSPIVAMTSRRSGVGLAVVNGQLYAVGG 565
                     .|::|.:   .:||              |.    :.....|.....:....|....
plant    96 ---------KNFVYLI---KECM--------------WE----VAEENLGESTCEIENVCYCYSN 130

  Fly   566 FDGSAYLKTIEVYDPETNQWRL----CGCMNYRRLGGGVG-------------VMRAPQTENYMW 613
                   |....||.:..:|||    .|...|.:....:|             |.|...|:. :|
plant   131 -------KRYWWYDAKCEEWRLVKGVSGLYEYYKTDSEIGNYGGKLVVFWDRAVSRLTATKE-IW 187

  Fly   614 C 614
            |
plant   188 C 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dboNP_524989.2 BTB_POZ_KLHL20_KLEIP 49..176 CDD:349558
PHA03098 69..587 CDD:222983 40/215 (19%)
KELCH repeat 359..403 CDD:276965 5/18 (28%)
KELCH repeat 407..451 CDD:276965 17/55 (31%)
KELCH repeat 454..497 CDD:276965 5/42 (12%)
KELCH repeat 501..545 CDD:276965 5/43 (12%)
KELCH repeat 548..593 CDD:276965 9/48 (19%)
AT4G19250NP_193660.1 Kelch_1 26..71 CDD:279660 15/44 (34%)
KELCH repeat 27..69 CDD:276965 15/41 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.