DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbo and AT4G11750

DIOPT Version :9

Sequence 1:NP_524989.2 Gene:dbo / 53556 FlyBaseID:FBgn0040230 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_192912.2 Gene:AT4G11750 / 826781 AraportID:AT4G11750 Length:386 Species:Arabidopsis thaliana


Alignment Length:183 Identity:54/183 - (29%)
Similarity:79/183 - (43%) Gaps:23/183 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 TRPRKPTR--RGEVLFAVGGWCSGDAIASVERF---DPQTNDWKMVAPMSK-RRCGVGVAVLNDL 370
            |.|.:.||  .|..::.|..:.:|   |...||   |.:::....|..|.| ::....:.||:..
plant   126 TPPSELTRITNGSNIYIVRVFTNG---AFSSRFLFMDCRSHTLHEVPRMDKTKKKPFMIRVLDGK 187

  Fly   371 LYAVGGHDGQSYLNSIERYDPQTNQWSCDVAPTTSCRTS--VGVAVLDGFLYAVGGQDGVQCLNH 433
            :|.:.|.....|.|.|||:|.:|..|....:|:...|.|  .|..|.||.||..|.:..|     
plant   188 IYVIEGCKNPDYSNLIERFDLKTQTWEHVPSPSAEIRGSYITGSLVYDGKLYLFGDKRVV----- 247

  Fly   434 VERYDPKENKWSKVA---PMTTRRLGVAVAVLGGFLYAIGGSDGQCPLNTVER 483
               |.||||||..|.   |:......:: .|:...:|:.|.|......||.||
plant   248 ---YKPKENKWDVVGLEMPLRWTPSYIS-CVVDNVIYSYGRSRVLMWYNTEER 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dboNP_524989.2 BTB_POZ_KLHL20_KLEIP 49..176 CDD:349558
PHA03098 69..587 CDD:222983 54/183 (30%)
KELCH repeat 359..403 CDD:276965 12/43 (28%)
KELCH repeat 407..451 CDD:276965 19/48 (40%)
KELCH repeat 454..497 CDD:276965 8/30 (27%)
KELCH repeat 501..545 CDD:276965
KELCH repeat 548..593 CDD:276965
AT4G11750NP_192912.2 F-box 11..51 CDD:279040
Kelch_1 183..220 CDD:279660 12/36 (33%)
KELCH repeat 224..263 CDD:276965 18/46 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.