Sequence 1: | NP_524989.2 | Gene: | dbo / 53556 | FlyBaseID: | FBgn0040230 | Length: | 623 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001326828.1 | Gene: | AT3G63220 / 825497 | AraportID: | AT3G63220 | Length: | 352 | Species: | Arabidopsis thaliana |
Alignment Length: | 239 | Identity: | 53/239 - (22%) |
---|---|---|---|
Similarity: | 78/239 - (32%) | Gaps: | 78/239 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 414 VLDGFLYAVGGQDGVQCLNHVE----------------------------------------RYD 438
Fly 439 PKENKWSKVAPMTTRRLGV-------------AVAVLGGFLYAIGGS-----------DGQCPLN 479
Fly 480 TVERYDPRHNKWVAVSPMSTRRKHLGCAVFNNYIYAVGGRDDCME-LSSAERYNPLTNTWS--PI 541
Fly 542 VAMTSRRSGVGLAVVNGQLYAVGGFDGSAYLKTIEVYDPETNQW 585 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dbo | NP_524989.2 | BTB_POZ_KLHL20_KLEIP | 49..176 | CDD:349558 | |
PHA03098 | 69..587 | CDD:222983 | 53/239 (22%) | ||
KELCH repeat | 359..403 | CDD:276965 | |||
KELCH repeat | 407..451 | CDD:276965 | 15/76 (20%) | ||
KELCH repeat | 454..497 | CDD:276965 | 11/66 (17%) | ||
KELCH repeat | 501..545 | CDD:276965 | 14/46 (30%) | ||
KELCH repeat | 548..593 | CDD:276965 | 10/38 (26%) | ||
AT3G63220 | NP_001326828.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 57 | 1.000 | Inparanoid score | I2576 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X9 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.960 |