DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbo and AT3G63220

DIOPT Version :9

Sequence 1:NP_524989.2 Gene:dbo / 53556 FlyBaseID:FBgn0040230 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_001326828.1 Gene:AT3G63220 / 825497 AraportID:AT3G63220 Length:352 Species:Arabidopsis thaliana


Alignment Length:239 Identity:53/239 - (22%)
Similarity:78/239 - (32%) Gaps:78/239 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 VLDGFLYAVGGQDGVQCLNHVE----------------------------------------RYD 438
            :|||...||    .::||.||.                                        .:|
plant    11 LLDGIPEAV----ALRCLAHVPLHLHPNLELVSRSWRAAIRSHELFRVRKELRSSEHLLCVCAFD 71

  Fly   439 PKENKWSKVAPMTTRRLGV-------------AVAVLGGFLYAIGGS-----------DGQCPLN 479
            | ||.|...:|...|.|.:             ......|.|:.:||.           ||....:
plant    72 P-ENIWQVYSPNCDRWLTLPLLPSRIRHLAHFGAVTTAGMLFVLGGGSDAVSPVTGDHDGTFATD 135

  Fly   480 TVERYDPRHNKWVAVSPMSTRRKHLGCAVFNNYIYAVGGRDDCME-LSSAERYNPLTNTWS--PI 541
            .|..||....:|...:.|...|....|.|....|...||...|.: :|.||.|:|..:.|:  |.
plant   136 QVWSYDFVQRQWTPRASMLVPRAMFACCVLQGKIVVAGGFTTCRKSISGAEMYDPENDVWTSIPD 200

  Fly   542 VAMTSRRSGVGLAVVNGQLYAVGGFDGSAYLKTIEVYDPETNQW 585
            :..|...:..|| ||||:::.:     ...|.|::|.:.....|
plant   201 LHQTHNSACSGL-VVNGKVHVL-----HKGLSTVQVLESVKLGW 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dboNP_524989.2 BTB_POZ_KLHL20_KLEIP 49..176 CDD:349558
PHA03098 69..587 CDD:222983 53/239 (22%)
KELCH repeat 359..403 CDD:276965
KELCH repeat 407..451 CDD:276965 15/76 (20%)
KELCH repeat 454..497 CDD:276965 11/66 (17%)
KELCH repeat 501..545 CDD:276965 14/46 (30%)
KELCH repeat 548..593 CDD:276965 10/38 (26%)
AT3G63220NP_001326828.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I2576
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.