DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbo and AT3G24610

DIOPT Version :9

Sequence 1:NP_524989.2 Gene:dbo / 53556 FlyBaseID:FBgn0040230 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_001319634.1 Gene:AT3G24610 / 822057 AraportID:AT3G24610 Length:375 Species:Arabidopsis thaliana


Alignment Length:268 Identity:60/268 - (22%)
Similarity:90/268 - (33%) Gaps:83/268 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 TNDWKMVAPMSKRR-----------------------CGVGVAVLNDLLYAVGGHDGQSYLNSIE 387
            :|:...|.|.||||                       |...|:.|:....::.....:|.:.|.|
plant     2 SNEAPEVEPHSKRRKKEASPSSSSGFLQSLPEAVAMICLARVSRLDHAALSLVSKSCRSMVLSPE 66

  Fly   388 RYDPQTNQ---------WSCDVAPT--TSC-------RTSVGVAVLDGFLYAVGGQDGVQCLNHV 434
            .|  ||..         :.|...||  |.|       ..|:.|..||             |.:| 
plant    67 LY--QTRSLIGYAEKFLYVCFCMPTDETLCCHEKINGNRSLNVLFLD-------------CRSH- 115

  Fly   435 ERYDPKENKWSKVAPMTTRRLGVAVAVLGGFLYAIGGSDGQCPLNTVERYDPRHNKWVAVS-PMS 498
                    ||..|..|...|:...|:|:.|.:...||...:...:..|.:||:...|..:| |..
plant   116 --------KWHHVTSMRVARVSPEVSVVDGKINVWGGCKYKHYYDWGEVFDPKTQTWADMSIPKP 172

  Fly   499 TRRKHLGCAVFNNYIYAVGGRDDCMELSSAERYNPLTNTWSPIVAMTSRRSGVGLAVVNGQLYAV 563
            .|.:.         ||.|    |..::.| ..|.|..:.|.. ....|:|| ....:::..:|:.
plant   173 VREEK---------IYVV----DSWDVGS-YYYLPSKSIWEK-GNQDSKRS-KDWCLIDKLIYSC 221

  Fly   564 GGFDGSAY 571
            |. ||..|
plant   222 GN-DGGIY 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dboNP_524989.2 BTB_POZ_KLHL20_KLEIP 49..176 CDD:349558
PHA03098 69..587 CDD:222983 60/268 (22%)
KELCH repeat 359..403 CDD:276965 11/75 (15%)
KELCH repeat 407..451 CDD:276965 9/43 (21%)
KELCH repeat 454..497 CDD:276965 11/43 (26%)
KELCH repeat 501..545 CDD:276965 8/43 (19%)
KELCH repeat 548..593 CDD:276965 7/24 (29%)
AT3G24610NP_001319634.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.