DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbo and AT2G44130

DIOPT Version :10

Sequence 1:NP_524989.2 Gene:dbo / 53556 FlyBaseID:FBgn0040230 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_566009.1 Gene:AT2G44130 / 819019 AraportID:AT2G44130 Length:409 Species:Arabidopsis thaliana


Alignment Length:239 Identity:62/239 - (25%)
Similarity:87/239 - (36%) Gaps:60/239 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   402 PTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSKVAPMTTRRLGV----AVAVL 462
            |...|....|::|                      |:...:.|.:||.....::.:    .|...
plant   106 PRVFCTPRFGLSV----------------------YNAAMSTWHRVAFPEEEQIPLFCECVVLQD 148

  Fly   463 GGFLYAIGGSDGQC--PLNTVERYDPRHNKWVAVSPMSTRRKHLGCA-VFNNYIYAVGGRDDCME 524
            .|.:..|||.|.:.  |...|...:....||...:||...|....|| |....:|..||.||...
plant   149 AGKILLIGGWDPETLQPTRDVYVLEFAGRKWRRGAPMKESRSFFACASVSPTKVYVAGGHDDQKN 213

  Fly   525 -LSSAERYNPLTNTWSPIVAMTSRRS-------GVGL--AVVNGQLYAV---GGF--DGSAYLKT 574
             |.|||.|:...:.||.:..||..|.       |:||  .|::|  |..   |.|  ||      
plant   214 ALRSAEVYDVEKDEWSSVTPMTEGRDECQGFAVGMGLRFCVLSG--YGTESQGRFRSDG------ 270

  Fly   575 IEVYDPETNQW-RLCGCMNY---RRLGGGVGVMRAPQTENYMWC 614
             |:|||.|:.| |:.....:   ...|...|..|:..|   :||
plant   271 -EIYDPATDSWSRIDNVWRFPDTSPRGRTAGDFRSSST---LWC 310

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
dboNP_524989.2 BTB_POZ_KLHL20_KLEIP 49..176 CDD:349558
PHA03098 69..587 CDD:222983 55/207 (27%)