DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbo and AT2G29830

DIOPT Version :9

Sequence 1:NP_524989.2 Gene:dbo / 53556 FlyBaseID:FBgn0040230 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_180544.1 Gene:AT2G29830 / 817533 AraportID:AT2G29830 Length:383 Species:Arabidopsis thaliana


Alignment Length:390 Identity:82/390 - (21%)
Similarity:135/390 - (34%) Gaps:118/390 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 DELNVRSEEQVFNAVMSWLKYNVAERRQHLAQVLQHVRLPLL--SPKFLVGTVGSDLLVRSDEAC 287
            |..|...:|:|.|                         ||:|  .|:.|:.::.: |:.|.....
plant    14 DNQNENPQEEVEN-------------------------LPILLQLPEELIASIVA-LIPRCHYPS 52

  Fly   288 RDLVDEAKNYLLLPQE-------------------------RPL----------MQGPRTRPRKP 317
            ..||..|..:|:..||                         ||.          :|..|.|...|
plant    53 LSLVSRAFRHLITSQELYVARSNLGFTEPVLYALIGFQAYTRPSWFFLRRSNFPLQLHRIRSLPP 117

  Fly   318 TRRGEV-------LFAVGGWCSG---DAIASVERFDPQTNDWKMVAPMSKRRCGVGVAVLNDLLY 372
            ...|..       ::.:|| |.|   .|.::|...|.:.:.||.:..|.:.||.....:::..:|
plant   118 MLSGAAVVTIDYKMYVMGG-CIGYNHPASSNVIVIDCRFHTWKYLPDMKRARCRAATGIIDGRIY 181

  Fly   373 AVGGHDGQSYLNSIERYDPQTNQWSCDVAPTTSCRTS-------VGVAVLDGFLYAVGGQDGVQC 430
            .:||...|. .:.:|.:|..|..|  :..| :.|...       :...|:.|.|:.:   |...|
plant   182 VIGGCKKQD-ADWVEVFDVTTQSW--ETVP-SECPNDANENGEFITYVVMQGRLFIL---DLECC 239

  Fly   431 LNHVERYDPKE---NKWSKVAPMTTRRLGVAVAVLGGFLYAIGGSDGQCPL-NTVERYDPRHNKW 491
            .:    |:|.:   ..|...:.:.......:..|:|..|||:   |..|.| :.:..|.|....|
plant   240 FS----YEPVQGLWESWDDGSELMRFWHSSSSCVVGDLLYAL---DLTCALEHPIVVYYPNELVW 297

  Fly   492 VAVSPMSTRRKHL--------GCAVFNNYIYAVGGRDDCMELSSAERYNPLTNTWSPIVAMTSRR 548
            ..|..:.|  .||        ..|.|:..:..:|| .||.|.||        ..|...:|:.:|:
plant   298 RPVMGVDT--AHLPILTEYTSTLANFDGKLVILGG-GDCSESSS--------EIWCVEIALETRQ 351

  Fly   549  548
            plant   352  351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dboNP_524989.2 BTB_POZ_KLHL20_KLEIP 49..176 CDD:349558
PHA03098 69..587 CDD:222983 82/390 (21%)
KELCH repeat 359..403 CDD:276965 10/43 (23%)
KELCH repeat 407..451 CDD:276965 8/53 (15%)
KELCH repeat 454..497 CDD:276965 12/43 (28%)
KELCH repeat 501..545 CDD:276965 13/51 (25%)
KELCH repeat 548..593 CDD:276965 0/1 (0%)
AT2G29830NP_180544.1 F-box 28..75 CDD:279040 12/47 (26%)
Kelch_1 118..165 CDD:279660 10/47 (21%)
KELCH repeat 120..164 CDD:276965 10/44 (23%)
Kelch_1 167..209 CDD:279660 11/45 (24%)
KELCH repeat 168..216 CDD:276965 12/51 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.