DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbo and AT2G22050

DIOPT Version :9

Sequence 1:NP_524989.2 Gene:dbo / 53556 FlyBaseID:FBgn0040230 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_179796.2 Gene:AT2G22050 / 816740 AraportID:AT2G22050 Length:259 Species:Arabidopsis thaliana


Alignment Length:104 Identity:25/104 - (24%)
Similarity:41/104 - (39%) Gaps:30/104 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   496 PMSTRRKHLGCAVFNNYIYAVGGRDDCMELSSAERYNPLTNTW-------------SPIVAMTSR 547
            |..:.......:...:.||.|||           .:.|::..|             |..||.|..
plant   126 PFPSHHSMYNSSAVGSEIYFVGG-----------SFEPMSELWILDTRTGMFRQGPSMKVARTDE 179

  Fly   548 RSGVGLAVVNGQLYAVGGFDGSAYLKTIEVYDPETNQWR 586
            .|   :.|:||::|.:||.:...   .:|||||::..|:
plant   180 AS---VGVINGKIYVIGGCEDKI---QVEVYDPKSRSWK 212

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
dboNP_524989.2 BTB_POZ_KLHL20_KLEIP 49..176 CDD:349558
PHA03098 69..587 CDD:222983 25/104 (24%)
KELCH repeat 359..403 CDD:276965
KELCH repeat 407..451 CDD:276965