| Sequence 1: | NP_524989.2 | Gene: | dbo / 53556 | FlyBaseID: | FBgn0040230 | Length: | 623 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001319995.1 | Gene: | AT4G19330 / 28720147 | AraportID: | AT4G19330 | Length: | 383 | Species: | Arabidopsis thaliana |
| Alignment Length: | 282 | Identity: | 59/282 - (20%) |
|---|---|---|---|
| Similarity: | 86/282 - (30%) | Gaps: | 95/282 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 386 IERYDPQ-TNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSKVAP 449
Fly 450 MT---TRRLGVAVAVLGGFLYAIGGSDGQCPLNTVERYDPRHNKWVAVSPMSTRRKHLGCAVFNN 511
Fly 512 YIYAVGGRDDCMELSSAERYNPLTNTWS--PIVAMTSRRSGV-GLAVVNGQLYAVGGFDGSAYL- 572
Fly 573 --------------KTIEV--------------YDPETNQWRL----CGCMNYRRLGGGVG---- 601
Fly 602 ---------VMRAPQTENYMWC 614 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dbo | NP_524989.2 | BTB_POZ_KLHL20_KLEIP | 49..176 | CDD:349558 | |
| PHA03098 | 69..587 | CDD:222983 | 49/236 (21%) | ||
| KELCH repeat | 359..403 | CDD:276965 | 6/17 (35%) | ||
| KELCH repeat | 407..451 | CDD:276965 | 4/43 (9%) | ||
| KELCH repeat | 454..497 | CDD:276965 | 11/42 (26%) | ||
| KELCH repeat | 501..545 | CDD:276965 | 13/45 (29%) | ||
| KELCH repeat | 548..593 | CDD:276965 | 14/78 (18%) | ||
| AT4G19330 | NP_001319995.1 | F-box | 34..76 | CDD:306992 | |
| BTB | <122..241 | CDD:333434 | 33/131 (25%) | ||
| NanM | 180..>326 | CDD:330881 | 30/145 (21%) | ||
| Kelch_1 | 181..226 | CDD:279660 | 13/44 (30%) | ||
| KELCH repeat | 182..224 | CDD:276965 | 12/41 (29%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 1 | 1.000 | - | - | X9 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||