DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dbo and klhl20

DIOPT Version :9

Sequence 1:NP_524989.2 Gene:dbo / 53556 FlyBaseID:FBgn0040230 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_001135481.1 Gene:klhl20 / 100216018 XenbaseID:XB-GENE-960635 Length:234 Species:Xenopus tropicalis


Alignment Length:169 Identity:134/169 - (79%)
Similarity:147/169 - (86%) Gaps:0/169 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PSPARLSHTSEKHPKVTLTELNMLRRHRELCDVVLNVGGRKIFAHRVILSACSSYFCAMFTGELE 106
            |.|||:.:.|:|||:.||..:|:||:|||||||||.||.:||:||||||||||.||.|||||||.
 Frog    38 PQPARMPYVSDKHPRQTLEVINLLRKHRELCDVVLVVGAKKIYAHRVILSACSPYFRAMFTGELA 102

  Fly   107 ESRQTEVTIRDIDENAMELLIDFCYTAHIIVEESNVQTLLPAACLLQLVEIQDICCEFLKRQLDP 171
            |||||||.||||||.||||||||.||:.|.|||.||||||||||||||.|||:.|||||||||||
 Frog   103 ESRQTEVVIRDIDERAMELLIDFSYTSQITVEEGNVQTLLPAACLLQLAEIQEACCEFLKRQLDP 167

  Fly   172 TNCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEF 210
            :||||||||||||||||||||||||||||||||.:|..|
 Frog   168 SNCLGIRAFADTHSCRELLRIADKFTQHNFQEVRDSVLF 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dboNP_524989.2 BTB_POZ_KLHL20_KLEIP 49..176 CDD:349558 98/126 (78%)
PHA03098 69..587 CDD:222983 120/142 (85%)
KELCH repeat 359..403 CDD:276965
KELCH repeat 407..451 CDD:276965
KELCH repeat 454..497 CDD:276965
KELCH repeat 501..545 CDD:276965
KELCH repeat 548..593 CDD:276965
klhl20NP_001135481.1 BTB 59..162 CDD:279045 83/102 (81%)
BTB 69..165 CDD:197585 78/95 (82%)
BACK_Kelch 165..>203 CDD:269808 35/37 (95%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 183 1.000 Domainoid score I3381
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 960 1.000 Inparanoid score I331
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D312716at33208
OrthoFinder 1 1.000 - - FOG0000036
OrthoInspector 1 1.000 - - oto103900
Panther 1 1.100 - - LDO PTHR24412
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X9
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.