DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment krz and arr3b

DIOPT Version :9

Sequence 1:NP_001247400.1 Gene:krz / 53554 FlyBaseID:FBgn0040206 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_957086.1 Gene:arr3b / 796867 ZFINID:ZDB-GENE-030616-74 Length:362 Species:Danio rerio


Alignment Length:356 Identity:167/356 - (46%)
Similarity:242/356 - (67%) Gaps:9/356 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 TRVFKKSSSNGKITVYLGKRDFVDHVTHVDPIDGVVFIDPEYVKDRKVFGQVLAAFRYGREDLDV 111
            |:|:||:|.||.:.:|||:|||||||..||.:|||:.|||..:..|||:.|:..|||||||||||
Zfish     2 TKVYKKTSGNGSLCLYLGRRDFVDHVESVDSVDGVLKIDPSGLNGRKVWVQLACAFRYGREDLDV 66

  Fly   112 LGLTFRKDLYLAHEQIYPPMQLDRPMTRLQERLIKKLGPNAHPFYFEVPPYCPASVSLQPAPGDV 176
            :|::||||:::...|:||......|.|.:||.|:||.|...|||.|::|.:.|.||||||||.|.
Zfish    67 IGVSFRKDIWIKRIQMYPFEGTKPPNTPMQEALLKKAGDQGHPFTFDIPVHLPCSVSLQPAPEDA 131

  Fly   177 GKSCGVDYELKAFVG---ENVEDKPHKRNSVRLTIRKVMYAPSKVGEQPSIEVSKEFMMKPNKIH 238
            ||.||||||:||::.   :|:::|..|:::.||.|||:.|||:::...|..:::|:|:.....||
Zfish   132 GKPCGVDYEVKAYIANEEDNIDEKVEKKDTCRLIIRKIQYAPAELAAGPKADINKQFITADKPIH 196

  Fly   239 LEATLDKELYHHGEKISVNVHVANNSNRTVKKIKVCVRQFADICLFSTAQYKSVVAEIESEDGCQ 303
            :|.:::||||:||:.|.:.|.|.|.:::.|||||:.:.|..|:.:::..:|...|  :..|.|.|
Zfish   197 MEVSMEKELYYHGDPIPIKVKVNNETSKVVKKIKINIFQITDVVIYAADKYHKCV--LNEEFGDQ 259

  Fly   304 VAPGFTLSKVFELCPLLANNKDKWGLALDGQLKHEDTNLASSTLITNPAQRESLGIMVHYKVKVK 368
            :....|..|.:.:.|||.|||:|.||||||:||.||||||||||:.....::..|::|.||:||.
Zfish   260 INANSTFEKEYSVTPLLVNNKEKRGLALDGRLKDEDTNLASSTLLIPDMDKQMQGVVVSYKIKVI 324

  Fly   369 LLISSPLL----NGDLVAELPFTLMHPKPEE 395
            |::...||    :.|:.||||..||.|||.|
Zfish   325 LMMGGGLLGSLTSSDVTAELPLVLMSPKPAE 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
krzNP_001247400.1 Arrestin_N 59..214 CDD:419887 82/157 (52%)
Arrestin_C 233..393 CDD:214976 69/163 (42%)
arr3bNP_957086.1 Arrestin_N 16..172 CDD:278754 82/155 (53%)
Arrestin_C 192..353 CDD:214976 69/162 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595702
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52566
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 1 1.000 - - FOG0000854
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.