DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment krz and Arrdc5

DIOPT Version :9

Sequence 1:NP_001247400.1 Gene:krz / 53554 FlyBaseID:FBgn0040206 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001102878.1 Gene:Arrdc5 / 680452 RGDID:1591748 Length:325 Species:Rattus norvegicus


Alignment Length:383 Identity:81/383 - (21%)
Similarity:142/383 - (37%) Gaps:117/383 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SSSNGKITVYLGKRDFVDHVTHVDPIDGVVFIDPEYVKDRKVFGQVLAAFRYGREDLDVLGLTFR 117
            |:.:|::.:.|..       |.|||:..|..:...||:..:..|:..   .|.|   ||  :...
  Rat    21 SNIDGQVVLTLNS-------TLVDPVVKVELVGRGYVEWNEEIGETR---DYSR---DV--ICNN 70

  Fly   118 KDLYLAHEQIYPPMQLDRPMTRLQERLIK----KLGPNAHPFYFEVPPYCPASVSLQPAPGDVGK 178
            |..|:...:.:|               ||    :.|.:...|:|.:||..|::.:        .|
  Rat    71 KADYVHKTKTFP---------------IKDNWLRAGSHTFDFHFNLPPRLPSTFN--------SK 112

  Fly   179 SCGVDYELKAF-VG-ENVEDKPHKRNSVRLTIRKVM-YAPSKVGEQP-SIEVSKEF---MMKPNK 236
            ...:.|.::|. :| |::..|  ||  :.|.::.:. :....:.|.| |:|..|:.   ......
  Rat   113 IGHISYFVQALCMGREHILAK--KR--LYLLVQGISEFRQRNLSENPLSVEAEKKVSYNCCSRGW 173

  Fly   237 IHLEATLDKELYHHGEKISVNVHVANNSNRTVKKIKVCVRQFADICLFSTAQYKSVVAEIE---- 297
            :.|...:.|..:..|||::....:.|::.:.:|.:     .||   |::..||:......|    
  Rat   174 VSLHVQMSKNTFVPGEKVTFTSEIRNHTGKYIKTV-----VFA---LYAHVQYEGFTPSAERRRR 230

  Fly   298 ---SEDGCQVA----PGF---TLSKVFELCPLLANNKDKWGLALDGQLKHEDTNLASSTLITNPA 352
               ||...|:|    |.|   |:...|.| ||:.:                    .||....|..
  Rat   231 ADSSELLRQMANARIPAFNSTTVVSAFNL-PLVLS--------------------VSSGSQENEI 274

  Fly   353 QRES--LGIMVH-------YKVKVKLLISS---PLLNGDLVAELPFTLMHPKPEEEEH 398
            .|.|  |.:.:|       .|..:.::|:|   ...|...|.|||:         |:|
  Rat   275 MRTSYELVVTIHLPWSLSTVKAGLPIIITSAREDKANCPQVNELPY---------EDH 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
krzNP_001247400.1 Arrestin_N 59..214 CDD:419887 33/161 (20%)
Arrestin_C 233..393 CDD:214976 39/185 (21%)
Arrdc5NP_001102878.1 Arrestin_N 13..124 CDD:419887 29/140 (21%)
Arrestin_C 170..304 CDD:397050 33/162 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.