DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment krz and SAG

DIOPT Version :9

Sequence 1:NP_001247400.1 Gene:krz / 53554 FlyBaseID:FBgn0040206 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_000532.2 Gene:SAG / 6295 HGNCID:10521 Length:405 Species:Homo sapiens


Alignment Length:424 Identity:193/424 - (45%)
Similarity:262/424 - (61%) Gaps:55/424 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VFKKSSSNGKITVYLGKRDFVDHVTHVDPIDGVVFIDPEYVKDRKVFGQVLAAFRYGREDLDVLG 113
            :|||.|.:..:|:|||.||::|||:.|.|:||||.:||:.||.:||:..:..|||||:||:||:|
Human    16 IFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIG 80

  Fly   114 LTFRKDLYLAHEQIYPPMQLDRPMTRLQERLIKKLGPNAHPFYFEVPPYCPASVSLQPAPGDVGK 178
            ||||:|||.:..|:|||:......|:|||.|:||||.|.:||....|.|.|.||.|||||.|.||
Human    81 LTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGK 145

  Fly   179 SCGVDYELKAFVGENV---EDKPHKRNSVRLTIRKVMYAPSKVGEQPSIEVSKEFMMKPNKIHLE 240
            |||||:|:|||..::.   |||..|::||||.||||.:||.::|.||..|.:.:|.|....:||.
Human   146 SCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLA 210

  Fly   241 ATLDKELYHHGEKISVNVHVANNSNRTVKKIKVCVRQFADICLFSTAQYKSVVAEIESEDGCQVA 305
            .:|:||:|.|||.|.|.|.|.||:.:||||||..|.|.|::.|:|:..|...||..|:::  :|.
Human   211 VSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQE--KVP 273

  Fly   306 PGFTLSKVFELCPLLANNKDKWGLALDGQLKHEDTNLASSTLITNPAQRESLGIMVHYKVKVKLL 370
            |..||:|...|.||||||:::.|:||||::|||||||||||:|.....|..|||:|.|::||||.
Human   274 PNSTLTKTLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLT 338

  Fly   371 IS---SPLLNGDLVAELPFTLMHPKPEEEEHPLLGERSPRASLAGGGLPLVSMSDGETESATGGQ 432
            :|   ..|.:.::..|:||.||||:||                           |...||     
Human   339 VSGFLGELTSSEVATEVPFRLMHPQPE---------------------------DPAKES----- 371

  Fly   433 DVPTTTNLIQLDDDEAQDDDIIFEDFARLRLKGA 466
                           .||.:::||:|||..||.|
Human   372 ---------------YQDANLVFEEFARHNLKDA 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
krzNP_001247400.1 Arrestin_N 59..214 CDD:419887 88/157 (56%)
Arrestin_C 233..393 CDD:214976 78/162 (48%)
SAGNP_000532.2 Arrestin_N 26..184 CDD:278754 88/157 (56%)
Arrestin_C 203..364 CDD:214976 78/162 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159518
Domainoid 1 1.000 203 1.000 Domainoid score I2963
eggNOG 1 0.900 - - E1_KOG3865
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52566
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 1 1.000 - - FOG0000854
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X758
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.820

Return to query results.
Submit another query.