DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment krz and sagb

DIOPT Version :9

Sequence 1:NP_001247400.1 Gene:krz / 53554 FlyBaseID:FBgn0040206 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001028921.1 Gene:sagb / 619268 ZFINID:ZDB-GENE-050913-98 Length:176 Species:Danio rerio


Alignment Length:150 Identity:85/150 - (56%)
Similarity:115/150 - (76%) Gaps:2/150 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VFKKSSSNGKITVYLGKRDFVDHVTHVDPIDGVVFIDPEYVKDRKVFGQVLAAFRYGREDLDVLG 113
            ::||.|.:..:.||:||||||||...|||:||||.||||.|||:|||..:...|||||||:||:|
Zfish     7 IYKKISRDKSVGVYMGKRDFVDHCDFVDPVDGVVLIDPEQVKDKKVFVMLSCTFRYGREDMDVMG 71

  Fly   114 LTFRKDLYLAHEQIYPPMQ-LDRPM-TRLQERLIKKLGPNAHPFYFEVPPYCPASVSLQPAPGDV 176
            :.||:|::|...|:|||:| .:|.: |::||::::|||.|||||:||.|...|.||:|||||.||
Zfish    72 MAFRRDIFLCMRQVYPPLQDKERSIHTKVQEKILRKLGGNAHPFFFEFPDNLPCSVTLQPAPNDV 136

  Fly   177 GKSCGVDYELKAFVGENVED 196
            ||.|.|::|:|||..||.:|
Zfish   137 GKQCAVEFEVKAFCAENQDD 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
krzNP_001247400.1 Arrestin_N 59..214 CDD:419887 81/139 (58%)
Arrestin_C 233..393 CDD:214976
sagbNP_001028921.1 Arrestin_N 17..150 CDD:304627 78/132 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595698
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52566
OrthoDB 1 1.010 - - D783081at2759
OrthoFinder 1 1.000 - - FOG0000854
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.