DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment krz and zgc:110626

DIOPT Version :9

Sequence 1:NP_001247400.1 Gene:krz / 53554 FlyBaseID:FBgn0040206 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001017889.1 Gene:zgc:110626 / 550588 ZFINID:ZDB-GENE-050417-447 Length:454 Species:Danio rerio


Alignment Length:283 Identity:68/283 - (24%)
Similarity:111/283 - (39%) Gaps:67/283 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 THVDPIDGVVFIDPEYVKDR-------KVFGQ--VLAAFRYGREDLDVLGLTFRKDLYLAHEQIY 128
            |..|.|.|.|.:  |.|||.       |:.|:  |..:.|:|:..:    |...|:.:.:.|:.:
Zfish    22 TSGDYISGKVIL--EVVKDTQMQSLSVKIKGKANVCWSERHGKTTV----LYSDKEKFYSVERFF 80

  Fly   129 PPMQLDRPMTRLQERL----------IKKLGPNAHPFYFEVPPYCPASVSLQPAP----GDVGKS 179
              :|.|.......|.|          :...|.:.:||.|::|        ||..|    |.||| 
Zfish    81 --VQTDTKHANDHEMLKDPSGQPYSSVVAPGRHVYPFTFQLP--------LQHFPSTYKGSVGK- 134

  Fly   180 CGVDYELKAFVGENVEDKPHKRNSVRLTIR---KVMYAPSKVGEQPSIEV----SKEFMMK---P 234
              |.|.|:..:.          .|:|::.:   :..|.|..|...|.:..    :|:..|.   .
Zfish   135 --VLYTLETKLS----------RSMRVSSKAKAEF
NYVPCPVVTNPELMAPQYGTKDKQMSFFTS 187

  Fly   235 NKIHLEATLDKELYHHGEKISVNVHVANNSNRTVKKIKVCVRQFADICLFSTAQYKSVVAEIESE 299
            ..:.:..:.:|..||.||.:.....|.|||:|.||. |.|:  :.....|:..:.|....:|..|
Zfish   188 GSVSMNISTEKMAYHLGEGLKFLAEVQNNSSRAVKP-KYCL--YEKHSFFARGKRKLHTHDIFKE 249

  Fly   300 DGCQVAPGF--TLSKVFELCPLL 320
            .|..:.|..  |::.|..:.|.|
Zfish   250 MGEPIEPSSKKTITTVLTIPPSL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
krzNP_001247400.1 Arrestin_N 59..214 CDD:419887 38/166 (23%)
Arrestin_C 233..393 CDD:214976 24/93 (26%)
zgc:110626NP_001017889.1 Arrestin_N 16..157 CDD:304627 38/163 (23%)
Arrestin_C 187..309 CDD:280848 24/89 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.