DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment krz and zgc:110353

DIOPT Version :9

Sequence 1:NP_001247400.1 Gene:krz / 53554 FlyBaseID:FBgn0040206 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001017785.1 Gene:zgc:110353 / 550482 ZFINID:ZDB-GENE-050417-310 Length:319 Species:Danio rerio


Alignment Length:386 Identity:82/386 - (21%)
Similarity:128/386 - (33%) Gaps:110/386 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SAGDETGGDASSRRQATRVFKKSSSNGKITVYL----GKRDFVDHVTHVDPIDGVVFIDPEYVKD 91
            |.||...|         ||..:.|...|||...    ||.:.....||.:  :.|.:.|.|    
Zfish    20 SNGDTLAG---------RVIVEVSKQTKITSLTVQAKGKANVAWTETHGE--ESVTYWDKE---- 69

  Fly    92 RKVFGQVLAAFRYGREDLDVLGLTFRKDLYLAHEQIYPPMQLDRPMTRLQERLIKKLGPNAHPFY 156
             |.|.|.                          :.:.|..:.|..:|.:       .|.:..||.
Zfish    70 -KYFSQT--------------------------QSVLPEDKADGSVTLV-------AGRHVFPFA 100

  Fly   157 FEVP-PYCPASVSLQPAPGDVGKSCGVDYELKAFVGENVEDKPHKRNSVRLT-IRKVMYAPSKVG 219
            |::| ...|:|..     |..||   :.|.|.|.:..:.  :...:...:.| :.:..|..|.:.
Zfish   101 FQLPNQSLPSSFK-----GVHGK---IHYRLMAKLSRSF--RAASKAEAKFTFVARADYDTSTLT 155

  Fly   220 EQPSIEVSKEFM-MKPNKIHLEATLDKELYHHGEKISVNVHVANNSNR-TVKKIKVCVRQFADIC 282
            ........|..| .....|.::..|.|..|..||.:.||..:.|:|.| .|.|..:..:|    .
Zfish   156 TPQHGSKDKNVMFFASGNISMDIFLPKTGYQQGEGLIVNGEIVNSSTRKIVPKYIIYQKQ----S 216

  Fly   283 LFSTAQYKSVVAEIESEDGCQVAPGFTLSKVFELCPLLANNKDKWGLALDGQLKHEDTNLASSTL 347
            .|:..|......||..|.| :.....|...::::.||...                    .|||:
Zfish   217 FFAGGQRAVHTTEILKEKG-EPLVSSTRENLYKVLPLPPE--------------------ISSTI 260

  Fly   348 ITNPAQRESLGIMVHYKVKVKLLISSPLLNGDLVAELPFTLMHPKPEEEEHPLLGERSPRA 408
                  .....:.|.|::||.|.:|   ...:.|.:|||.::         ||..|..|:|
Zfish   261 ------HNCRILKVEYRLKVILDVS---FTKNPVIKLPFIVL---------PLCNETPPKA 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
krzNP_001247400.1 Arrestin_N 59..214 CDD:419887 29/160 (18%)
Arrestin_C 233..393 CDD:214976 36/160 (23%)
zgc:110353NP_001017785.1 Arrestin_N 6..149 CDD:304627 37/187 (20%)
Arrestin_C 171..293 CDD:280848 36/155 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.