DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment krz and Sag

DIOPT Version :9

Sequence 1:NP_001247400.1 Gene:krz / 53554 FlyBaseID:FBgn0040206 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_037155.2 Gene:Sag / 25539 RGDID:3619 Length:403 Species:Rattus norvegicus


Alignment Length:429 Identity:197/429 - (45%)
Similarity:265/429 - (61%) Gaps:57/429 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VFKKSSSNGKITVYLGKRDFVDHVTHVDPIDGVVFIDPEYVKDRKVFGQVLAAFRYGREDLDVLG 113
            :|||.|.:..:|:||||||::|||:.|:|:||||.:|||.||.:||:..:..|||||:||:||:|
  Rat    13 IFKKVSRDKSVTIYLGKRDYIDHVSQVEPVDGVVLVDPELVKGKKVYVTLTCAFRYGQEDIDVIG 77

  Fly   114 LTFRKDLYLAHEQIYPPMQLDRPMTRLQERLIKKLGPNAHPFYFEVPPYCPASVSLQPAPGDVGK 178
            ||||:|||.:..|:|||:......|:||..|:||||.|.:||....|.|.|.||.|||||.||||
  Rat    78 LTFRRDLYFSRVQVYPPVGAMSAPTQLQLSLLKKLGDNTYPFLLTFPDYLPCSVMLQPAPQDVGK 142

  Fly   179 SCGVDYELKAF---VGENVEDKPHKRNSVRLTIRKVMYAPSKVGEQPSIEVSKEFMMKPNKIHLE 240
            |||||:|:|||   :.:..|||..|::||||.||||.:||.::|.||..|.|.:|.|....:||.
  Rat   143 SCGVDFEVKAFATDITDAEEDKIPKKSSVRLLIRKVQHAPPEMGPQPCAEASWQFFMSDKPLHLS 207

  Fly   241 ATLDKELYHHGEKISVNVHVANNSNRTVKKIKVCVRQFADICLFSTAQYKSVVAEIESEDGCQVA 305
            .:|.||:|.|||.|.|.|.|.||:.:.||||||.|.|.|::.|:|:..|...||..|:::  :|.
  Rat   208 VSLSKEIYFHGEPIPVTVTVTNNTEKVVKKIKVSVEQIANVVLYSSDYYVKPVASEETQE--KVQ 270

  Fly   306 PGFTLSKVFELCPLLANNKDKWGLALDGQLKHEDTNLASSTLITNPAQRESLGIMVHYKVKVKLL 370
            |..||:|...|.||||||:::.|:||||::|||||||||||:|.....|..:||:|.|.:||||.
  Rat   271 PNSTLTKTLVLVPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVMGILVSYHIKVKLT 335

  Fly   371 IS---SPLLNGDLVAELPFTLMHPKPEEEEHPLLGERSPRASLAGGGLPLVSMSDGETESATGGQ 432
            :|   ..|.:.::..|:||.||||:||                           |...||     
  Rat   336 VSGFLGELTSSEVATEVPFRLMHPQPE---------------------------DPAKES----- 368

  Fly   433 DVPTTTNLIQLDDDEAQDDDIIFEDFARLRLK--GAETE 469
                           .||::::||:|||..||  |..||
  Rat   369 ---------------VQDENLVFEEFARQNLKDTGENTE 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
krzNP_001247400.1 Arrestin_N 59..214 CDD:419887 90/157 (57%)
Arrestin_C 233..393 CDD:214976 77/162 (48%)
SagNP_037155.2 Arrestin_N 23..181 CDD:419887 90/157 (57%)
Arrestin_C 200..361 CDD:214976 77/162 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..403 6/12 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353564
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52566
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 1 1.000 - - FOG0000854
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X758
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.