DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment krz and Arr3

DIOPT Version :9

Sequence 1:NP_001247400.1 Gene:krz / 53554 FlyBaseID:FBgn0040206 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001177922.1 Gene:Arr3 / 171107 RGDID:621385 Length:381 Species:Rattus norvegicus


Alignment Length:368 Identity:178/368 - (48%)
Similarity:248/368 - (67%) Gaps:15/368 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VFKKSSSNGKITVYLGKRDFVDHVTHVDPIDGVVFIDPEYVKDRKVFGQVLAAFRYGREDLDVLG 113
            ||||:|||||.::|||||||||.|..|:|||||:.:||||:|.||:|.::..||||||:||||:|
  Rat     4 VFKKTSSNGKFSIYLGKRDFVDDVDTVEPIDGVILVDPEYLKGRKMFVRLTCAFRYGRDDLDVIG 68

  Fly   114 LTFRKDLYLAHEQIYP--PMQLDRPMTRLQERLIKKLGPNAHPFYFEVPPYCPASVSLQPAPGDV 176
            ||||||||:..:|:.|  |..:..|:|.|||||:.|||.||:||..::....|.||:|||.|.|.
  Rat    69 LTFRKDLYVQTKQVAPAEPTSIQGPLTALQERLLHKLGVNAYPFTLQMVANLPCSVTLQPGPEDS 133

  Fly   177 GKSCGVDYELKAFVGENVEDKPHKRNSVRLTIRKVMYAPSKVGEQPSIEVSKEFMMKPNKIHLEA 241
            ||.||||:|:|:|..||:|:|..|.:||:|.:|||.::..:.|..|..:..:.|.:....:.|:|
  Rat   134 GKPCGVDFEVKSFCAENLEEKISKSDSVQLVVRKVQFSALEPGPGPWAQTIRSFFLSSQPLQLQA 198

  Fly   242 TLDKELYHHGEKISVNVHVANNSNRTVKKIKVCVRQFADICLFSTAQYKSVVAEIESEDGCQVAP 306
            .:|:|:::|||.|||:|.:.|.:|:.:::||:.|.|..|:.|:|..:|...|...|..:  .||.
  Rat   199 WMDREVHYHGEAISVHVSINNYTNKVIRRIKIAVIQITDVVLYSLDKYTKTVFIREFTE--TVAA 261

  Fly   307 GFTLSKVFELCPLLANNKDKWGLALDGQLKHEDTNLASSTLITNPAQRESLGIMVHYKVKVKLLI 371
            ..:.|:.|.:.||||.|:.|.||||||:||||||||||||::.....:|.|||:|.|||||.|::
  Rat   262 NSSFSQTFAVTPLLAANRQKQGLALDGKLKHEDTNLASSTILRPGMNKELLGILVSYKVKVNLMV 326

  Fly   372 S-SPLLNG----DLVAELPFTLMHPKPEEEEHPLLGERSPRAS 409
            | ..:|.|    |:..|||..|:||||..      |||:...|
  Rat   327 SYGGILGGLPASDVGVELPLILIHPKPPH------GERAVATS 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
krzNP_001247400.1 Arrestin_N 59..214 CDD:419887 88/156 (56%)
Arrestin_C 233..393 CDD:214976 72/164 (44%)
Arr3NP_001177922.1 Arrestin_N 14..171 CDD:278754 88/156 (56%)
Arrestin_C 190..353 CDD:214976 72/164 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353563
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.810

Return to query results.
Submit another query.