DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment krz and AgaP_AGAP009257

DIOPT Version :9

Sequence 1:NP_001247400.1 Gene:krz / 53554 FlyBaseID:FBgn0040206 Length:470 Species:Drosophila melanogaster
Sequence 2:XP_320049.3 Gene:AgaP_AGAP009257 / 1280220 VectorBaseID:AGAP009257 Length:298 Species:Anopheles gambiae


Alignment Length:224 Identity:51/224 - (22%)
Similarity:88/224 - (39%) Gaps:56/224 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 LEATLDKELYHHGEKISVNVHVANNSNRTVKKIKVCVRQFADI--CLFSTAQYKSVVAEIESEDG 301
            |:..||||.|:.||.:|..|.:....|..:|.|::.:|..|.:  .:|.:...::|..:....|.
Mosquito     7 LDIRLDKEHYYAGEVLSGRVIMHTTENFKLKSIRLLLRGKAHVEWKVFVSGDKRTVKDDQVYIDE 71

  Fly   302 CQVAPGFTLSKVFEL-CPLLANNKDKWGLALDGQLKHEDTNLASSTLITNPAQRESLGIMVHYKV 365
            ..|..|....:..:: .|:|...:.::..    :....:|||        |...||....:.|.|
Mosquito    72 RAVIWGERAGEGLDVTVPVLVRGQHQFPF----RFNIPETNL--------PCSFESRACYIRYFV 124

  Fly   366 KVKLLI--SSPLLNGDLVAELP-----FTLMHPKPE--EEEH--PLLGE-----------RSP-- 406
            ||.:.|  :||          |     ||::.|..:  :|::  |:.|:           :.|  
Mosquito   125 KVTIDIPYASP----------PQGIKYFTIIGPHIDCMDEQYLKPVSGQDKKVKCCLCCAKGPVT 179

  Fly   407 -------RASLAGGGLPLVSMSDGETESA 428
                   .|...|..|.|.|:.|.:.|.|
Mosquito   180 LSCSLDRTAFCCGETLKLKSIIDNQGEEA 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
krzNP_001247400.1 Arrestin_N 59..214 CDD:419887
Arrestin_C 233..393 CDD:214976 39/163 (24%)
AgaP_AGAP009257XP_320049.3 Arrestin_N 7..148 CDD:278754 38/162 (23%)
Arrestin_C 175..280 CDD:214976 9/34 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.