DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment krz and lurap1l

DIOPT Version :9

Sequence 1:NP_001247400.1 Gene:krz / 53554 FlyBaseID:FBgn0040206 Length:470 Species:Drosophila melanogaster
Sequence 2:XP_002940173.1 Gene:lurap1l / 100380016 XenbaseID:XB-GENE-958293 Length:200 Species:Xenopus tropicalis


Alignment Length:96 Identity:28/96 - (29%)
Similarity:35/96 - (36%) Gaps:22/96 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 LKHEDTNLASSTLITNPAQRESLGIMVHYKVKVKLLISSPLLNGDLVAELPFTLMHPKPEEEEHP 399
            |:..|..|....||.|.: .||:..|:..|..|....||  |:|.|.:.|               
 Frog    77 LRATDVKLMRQLLIINES-IESIKWMMEEKDIVTSQGSS--LSGSLCSLL--------------- 123

  Fly   400 LLGERSPRASLAGGGLPLVSMSDGETESATG 430
                .|..|||.|....|...|||..|.:.|
 Frog   124 ----ESNDASLRGSCNSLQDCSDGMDEMSVG 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
krzNP_001247400.1 Arrestin_N 59..214 CDD:419887
Arrestin_C 233..393 CDD:214976 17/57 (30%)
lurap1lXP_002940173.1 LURAP 57..163 CDD:373342 28/96 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165177395
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.