DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment krz and arr3

DIOPT Version :9

Sequence 1:NP_001247400.1 Gene:krz / 53554 FlyBaseID:FBgn0040206 Length:470 Species:Drosophila melanogaster
Sequence 2:XP_012823333.1 Gene:arr3 / 100124859 XenbaseID:XB-GENE-966159 Length:387 Species:Xenopus tropicalis


Alignment Length:431 Identity:193/431 - (44%)
Similarity:272/431 - (63%) Gaps:58/431 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 QATRVFKKSSSNGKITVYLGKRDFVDHVTHVDPIDGVVFIDPEYVKDRKVFGQVLAAFRYGREDL 109
            :.::||||||::||:::||.|||:||||.||:|:||::.|||||.||:|||..:...|||||:|.
 Frog     3 EGSKVFKKSSADGKLSIYLAKRDYVDHVDHVEPVDGMILIDPEYQKDKKVFVTLTCTFRYGRDDH 67

  Fly   110 DVLGLTFRKDLYLAHEQIYPPMQLD-RPMTRLQERLIKKLGPNAHPFYFEVPPYCPASVSLQPAP 173
            :::||:|:||||..|.|:|||:..| :.:|.|||:|.||||.||.||.|.:....|.||:|||.|
 Frog    68 ELIGLSFKKDLYFLHCQVYPPLPEDKKALTPLQEKLAKKLGQNAFPFCFNMATDLPCSVTLQPGP 132

  Fly   174 GDVGKSCGVDYELKAFVGENVEDKPHKRNSVRLTIRKVMYAPSKVGEQPSIEVSKEFMMKPNKIH 238
            .|.||.||||:|:|.|..||||:|..::|||:|.||||.:||...|..|.::.:::|||....:.
 Frog   133 EDTGKKCGVDFEVKGFCAENVEEKVPRKNSVQLIIRKVQFAPEATGPAPCVQTTRQFMMSDRPLQ 197

  Fly   239 LEATLDKELYHHGEKISVNVHVANNSNRTVKKIKVCVRQFADICLFSTAQYKSVVAEIESEDGCQ 303
            |||:|:||:|:|||.|.|||.:.||:::.|||||:.|.|..|:.|:|..:|..:|...|..|  .
 Frog   198 LEASLNKEIYYHGEPIGVNVKITNNTSKIVKKIKITVEQLTDVVLYSLDKYTKIVCCEEMND--T 260

  Fly   304 VAPGFTLSKVFELCPLLANNKDKWGLALDGQLKHEDTNLASSTLITNPAQRESLGIMVHYKVKVK 368
            ||...|.|..:.:.||||||::|.||||||:|||.||||||||::.....:|.||::|.|||:|.
 Frog   261 VAANGTFSGSYSVTPLLANNREKRGLALDGKLKHGDTNLASSTILRPGMDKEVLGMLVSYKVRVN 325

  Fly   369 LLIS-----SPLLNGDLVAELPFTLMHPKPEEEEHPLLGERSPRASLAGGGLPLVSMSDGETESA 428
            |:::     ..|.:.|::.:||.|||||||.                                  
 Frog   326 LVVARGGILGDLTSSDVLVDLPLTLMHPKPS---------------------------------- 356

  Fly   429 TGGQDVPTTTNLIQLDDDEAQDDDIIFEDFARLRLKGAETE 469
                  |..||:          :|::.|:|||.:|:|||.|
 Frog   357 ------PDQTNI----------EDVVIEEFARQKLQGAEGE 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
krzNP_001247400.1 Arrestin_N 59..214 CDD:419887 87/155 (56%)
Arrestin_C 233..393 CDD:214976 76/164 (46%)
arr3XP_012823333.1 Arrestin_N 17..173 CDD:334019 87/155 (56%)
Arrestin_C 192..355 CDD:214976 76/164 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 227 1.000 Domainoid score I2445
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 487 1.000 Inparanoid score I1402
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D340461at33208
OrthoFinder 1 1.000 - - FOG0000854
OrthoInspector 1 1.000 - - otm48094
Panther 1 1.100 - - O PTHR11792
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X758
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.