DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and Clec4g

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_083741.1 Gene:Clec4g / 75863 MGIID:1923113 Length:294 Species:Mus musculus


Alignment Length:220 Identity:49/220 - (22%)
Similarity:87/220 - (39%) Gaps:38/220 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SANEVQVNETRKQLAKIEGQEKETNDKIKVIHDNVDNEFNALSAKIKNVKNIQRHLASLELQLQE 121
            |..:.|:..|..:...|:.:..|....:|.:.:.|..:   |:...::.:||:..|    .|..|
Mouse    96 SVTKAQLQTTLAEFKDIQAKLMEQESILKELQERVTQD---LAKASRDRENIRSEL----FQALE 153

  Fly   122 TKKALNLSVEAKKVMPKTEIPSQFQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDEL 186
            ..|..|.|.|.   .|.:.:|.|    |..::|.|.  :..|..|.|.|...||||:.::..:|.
Mouse   154 AVKRQNSSCEQ---CPPSWLPFQ----GSCYYFSET--QATWDTAQSYCGGQGAHLVIVRGLNEQ 209

  Fly   187 DAIRTELKDINDGSHDFWLDINDIA--------KWGEFISLATGMNPPFLKWHKHRP-QVQIHQR 242
            ..:....:     ...:||.:..:.        :|.:..||      .|..|:...| ..:.|:.
Mouse   210 GFLSQHTR-----GRGYWLGLRAVRHLNKIQGYRWVDGASL------NFSHWNSGEPNDSRGHED 263

  Fly   243 CV-HLRGGEMMDGKC-SEQFLFICQ 265
            |: .|..|...|..| :|:..:||:
Mouse   264 CIMMLHSGLWNDAPCTNERDGWICE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 25/117 (21%)
Clec4gNP_083741.1 COG6 61..>163 CDD:303003 16/73 (22%)
CLECT 165..289 CDD:295302 32/141 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.