DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and Colec11

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001300907.1 Gene:Colec11 / 71693 MGIID:1918943 Length:278 Species:Mus musculus


Alignment Length:279 Identity:53/279 - (18%)
Similarity:95/279 - (34%) Gaps:70/279 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CPRMSTDKEVCLVE-LAPVLKYISNNHKSHWNSANEVQVNETRK--------------QLAKI-- 73
            ||:.:|: :.|.|: |.|.||..:.............:|..|.:              :..||  
Mouse    25 CPQQTTE-DACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGTVGRHGKIGP 88

  Fly    74 ---EGQEKETND-----------------KIKVIHDNVDNEFNALSAKIKNVKNIQRHLASLELQ 118
               :|::.::.|                 :::.....:||:...|:.::|.:||.....|:: ..
Mouse    89 IGAKGEKGDSGDIGPPGPSGEPGIPCECSQLRKAIGEMDNQVTQLTTELKFIKNALPSPAAV-AG 152

  Fly   119 LQETKKALNLSVEAKKVMPKTEIPSQFQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSE 183
            ::||:..:.|.|:                        |:|...|   |...|...|..|...:.|
Mouse   153 VRETESKIYLLVK------------------------EEKRYAD---AQLSCQARGGTLSMPKDE 190

  Fly   184 DELDAIRTELKDINDGSHDFWLDINDIAKWGEFISLATGMNPPFLKWHKHRP-QVQIHQRCVHL- 246
            .....:.:.|...  |....::.|||:.|.|.|:.........|.||....| .....:.||.: 
Mouse   191 AANGLMASYLAQA--GLARVFIGINDLEKEGAFVYSDRSPMQTFNKWRSGEPNNAYDEEDCVEMV 253

  Fly   247 RGGEMMDGKCSEQFLFICQ 265
            ..|...|..|.....|:|:
Mouse   254 ASGGWNDVACHITMYFMCE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 25/108 (23%)
Colec11NP_001300907.1 Collagen 41..96 CDD:189968 8/54 (15%)
CLECT_collectin_like 158..273 CDD:153061 29/144 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10387
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4956
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.