DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and CLEC3B

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_016862606.1 Gene:CLEC3B / 7123 HGNCID:11891 Length:209 Species:Homo sapiens


Alignment Length:176 Identity:44/176 - (25%)
Similarity:71/176 - (40%) Gaps:19/176 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 RHLASLELQ-----LQETKKALNLSVEAKKVMPKTE------IPSQFQKIGWRHFFIEKKHKVDW 163
            :|..|..||     |..|..||..:..||......|      :..:..|:..:.|....:.|. :
Human    35 QHFLSSLLQSQLYPLSPTLPALRRTDPAKGTWQALEACLGCLVCLKGTKVHMKCFLAFTQTKT-F 98

  Fly   164 FKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLDINDIAKWGEFISLATGMNPPFL 228
            .:|:..|...|..|.|.|:..|.||:...|:.......:.||.:||:|..|.::.: ||....:.
Human    99 HEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDM-TGARIAYK 162

  Fly   229 KWHKH---RPQVQIHQRCVHLRG---GEMMDGKCSEQFLFICQLAV 268
            .|...   :|.....:.|..|.|   |:..|.:|.:|..:|||..:
Human   163 NWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGI 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 29/112 (26%)
CLEC3BXP_016862606.1 CLECT_tetranectin_like 78..206 CDD:153066 32/129 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I5471
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.