DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and Cd209g

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_006508948.1 Gene:Cd209g / 70192 MGIID:1917442 Length:295 Species:Mus musculus


Alignment Length:226 Identity:40/226 - (17%)
Similarity:80/226 - (35%) Gaps:61/226 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 ANEVQVNETRKQLAKIEGQEKETN-----DKIKVIHDNVDNEFNALSAKIKNVKNIQRHLASLEL 117
            |..|||:..|   |..:||.::..     ||:.|..:..       .:.::.::.||:.|.....
Mouse   104 ATLVQVSRIR---AYSQGQTQDQQGSSSLDKVAVPREQT-------HSGLEQIQQIQQQLTQFNA 158

  Fly   118 QLQETKKALNLSVEAKKVMPKTEIPSQFQKIGWRHF----FIEKKHKVDWFKATSMCHKMGAHLL 178
            .|....:                 |..:.   |..|    ::..:....|..:.|.|..:||||:
Mouse   159 SLAGLCR-----------------PCPWD---WELFQGSCYLFSRTLGSWETSASSCEDLGAHLV 203

  Fly   179 TIQSEDELDAI------RTELKDINDGSHDFWLDINDIAKWGEFISLATGMNPPFLK---WHKHR 234
            .:.|..|...:      :.:|.         |:.::|....|.:    ..::...||   |.:..
Mouse   204 IVNSVSEQQFLKYWHIRKNQLT---------WIGLSDHRSEGSW----QWVDDTPLKLSFWKEGE 255

  Fly   235 PQVQIHQRCVHLRGGEMMDGKCSEQFLFICQ 265
            |..:..:.||.:...:..|.:|:....::|:
Mouse   256 PNNEGDEDCVVMAEDKWNDSRCTANNFWVCE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 21/115 (18%)
Cd209gXP_006508948.1 CLECT_DC-SIGN_like 167..286 CDD:153060 23/134 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.