DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and Cd209f

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_001068161.4 Gene:Cd209f / 688750 RGDID:1585258 Length:277 Species:Rattus norvegicus


Alignment Length:274 Identity:49/274 - (17%)
Similarity:94/274 - (34%) Gaps:74/274 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 HKSHWNSANEVQVNETRKQLAKIEGQEKETNDKIKVIHDNVDNEFNALSAK-------------- 101
            :||......|....|.:|...|.|..:...:::...:.|: |.|....|:|              
  Rat     4 YKSQVRGKEERGSPEKQKMAGKPELHQPNNHEEEVTLEDH-DPEGLICSSKSLQGHLTRAPWLLP 67

  Fly   102 -----------IKNVKNIQRHLASLELQLQETKKALNLSVEAKKVMPKTEIPS---QFQKI---- 148
                       :..:..|.|..|:.:.|.|:.|.:   |...|..:|:.:..:   |.|:|    
  Rat    68 LLISLGLFLLMLATLVQISRICANPQGQTQDQKGS---SSFGKVAVPQEQTYTGLEQIQQIQQQL 129

  Fly   149 ----------------GWRHF----FIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIR--- 190
                            .|..|    ::..:....|..:.|.|..:||||:.:.|..|...::   
  Rat   130 TQFNASLAGLCRPCPWDWEFFQGSCYLFSRTLASWGASASSCKDLGAHLVIVNSVAEQQFLKYWH 194

  Fly   191 ---TELKDINDGSHDFWLDINDIAKWGEFISL-ATGMNPPFLKWHKHRPQVQIHQRCVHLRGGEM 251
               ::|.         |:.::|..:.|.:..: .|.:...|  |.:..|.....:.||.:...:.
  Rat   195 IRQSQLT---------WIGLSDHQREGSWQWVDDTPLKLSF--WKEGEPNNAGDEDCVVIAEDKW 248

  Fly   252 MDGKCSEQFLFICQ 265
            .|..||....::|:
  Rat   249 NDSTCSANNFWVCE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 22/113 (19%)
Cd209fXP_001068161.4 CLECT_DC-SIGN_like 143..262 CDD:153060 24/129 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.