Sequence 1: | NP_652642.2 | Gene: | lectin-21Ca / 53552 | FlyBaseID: | FBgn0040107 | Length: | 269 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001035139.1 | Gene: | illr1 / 677756 | ZFINID: | ZDB-GENE-050311-2 | Length: | 253 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 50/200 - (25%) |
---|---|---|---|
Similarity: | 80/200 - (40%) | Gaps: | 39/200 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 88 HDNVDNEFNALSAKIKNVKNIQRHLASLELQLQETKKALNLSVEAKKVMPKTEIPSQFQKIGWRH 152
Fly 153 ------FFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELK--------DINDGSHDF 203
Fly 204 WLDINDIAKWGEF-ISLATGMNPPFLKWHKHRPQVQIHQRCVHL--RGGE---MMDGKCSEQFLF 262
Fly 263 ICQLA 267 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-21Ca | NP_652642.2 | CLECT | 158..265 | CDD:153057 | 31/120 (26%) |
illr1 | NP_001035139.1 | CLECT_DC-SIGN_like | 115..248 | CDD:153060 | 34/138 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22802 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |