DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and BCAN

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_016857536.1 Gene:BCAN / 63827 HGNCID:23059 Length:956 Species:Homo sapiens


Alignment Length:129 Identity:29/129 - (22%)
Similarity:56/129 - (43%) Gaps:16/129 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 FQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLDIND 209
            ||...::||...:    .|.:|.:.|...||||.:|.:.:|.|.|....::..      |:.:||
Human   740 FQGACYKHFSTRR----SWEEAETQCRMYGAHLASISTPEEQDFINNRYREYQ------WIGLND 794

  Fly   210 IAKWGEFISLATGMNPPFLKWHKHRPQVQI--HQRCVHL---RGGEMMDGKCSEQFLFICQLAV 268
            ....|:|: .:.|:...:..|:..:|....  .:.||.:   ..|:..|..|:....:.|::.:
Human   795 RTIEGDFL-WSDGVPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKMGL 857

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 24/111 (22%)
BCANXP_016857536.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4956
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.