DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and CLEC11A

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_002966.1 Gene:CLEC11A / 6320 HGNCID:10576 Length:323 Species:Homo sapiens


Alignment Length:244 Identity:37/244 - (15%)
Similarity:73/244 - (29%) Gaps:75/244 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 HKSHWN-SANEVQVNETRKQLAKIEGQEKETNDKIKVIHD---NVDNEFNALSAKIKNVKNIQRH 111
            |:.|.. .|.:.:|.|..:.|.::.....:|.|.::.:.:   ..:.|...|...:|.:      
Human   123 HQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGL------ 181

  Fly   112 LASLELQLQETKKALNLSVEAKKVMPKTEIPSQFQKIGWRHFFIEKKHKVDWFKATSMCHKMGAH 176
                                               ::|.:.|.:.:..:.. ..|.:.|...|..
Human   182 -----------------------------------RLGHKCFLLSRDFEAQ-AAAQARCTARGGS 210

  Fly   177 LLTIQSEDELDA----IRTELKDINDGSHDFWLDINDIAKWGEFISLATGMNPPFLKWHKH---- 233
            |.......:::|    :|..|...|   ...||.::|....|.:: ...|....|..||:.    
Human   211 LAQPADRQQMEALTRYLRAALAPYN---WPVWLGVHDRRAEGLYL-FENGQRVSFFAWHRSPRPE 271

  Fly   234 ---RPQVQIH------------QRCVHLRG--GEMMDGKCSEQFLFICQ 265
               :|....|            :.||....  |...|..|..:..::|:
Human   272 LGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 23/131 (18%)
CLEC11ANP_002966.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..106
Cell attachment site. /evidence=ECO:0000255 61..63
CLECT_tetranectin_like 177..321 CDD:153066 27/190 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..295 2/22 (9%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.