DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and hbl2

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_009296949.2 Gene:hbl2 / 566971 ZFINID:ZDB-GENE-070912-286 Length:253 Species:Danio rerio


Alignment Length:174 Identity:28/174 - (16%)
Similarity:67/174 - (38%) Gaps:38/174 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 VKNIQRHLASLELQLQETKKALNLSVEAKKVMPKTEIPSQFQKIGWRHFFIEKKHKVDWFKATSM 169
            :::::..:.:|:.::...:||.:.              |.|:::| :.:::......::......
Zfish   104 IESLKSEIQNLKAEIDTIEKAASF--------------SNFRRVG-QKYYVTDGILGNFNDGIKF 153

  Fly   170 CHKMGAHLLTIQSEDELDA-IRTELKD-INDGSHDFWLDINDIAKWGEFISLATGMNPPFLKWHK 232
            |...|..|:..::..|..| :|..:.. ::.|..  ::.:.|....|:|:.: .|....|..|..
Zfish   154 CKDAGGTLVVPKTAAENQALVRVSVSSALSTGKP--YIGVTDRETEGQFVDI-EGKQLTFTNWGP 215

  Fly   233 HRPQVQIHQRCVHLRGGE----------MMDGKCSEQFLFICQL 266
            .:|.        ..|||:          ..||.|.:....||::
Zfish   216 GQPD--------DYRGGQDCGVIEVSGTWDDGNCGDIRPIICEI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 21/118 (18%)
hbl2XP_009296949.2 Collagen <36..70 CDD:189968
CLECT_collectin_like 135..251 CDD:153061 22/126 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.