DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and si:ch211-63p21.3

DIOPT Version :10

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_068078914.1 Gene:si:ch211-63p21.3 / 562103 ZFINID:ZDB-GENE-160113-18 Length:377 Species:Danio rerio


Alignment Length:115 Identity:27/115 - (23%)
Similarity:52/115 - (45%) Gaps:14/115 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 HFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLDI--NDIAKWG 214
            ||..|.|   :|.:|...|.:....|.|:.:.::::.::..| |:|.|.  .|:.:  .:::.| 
Zfish    26 HFINENK---NWTEAQRYCRENYTDLATVDNMNDMNQLKNSL-DVNYGV--VWIGLQGTNVSNW- 83

  Fly   215 EFISLATGMNPPFLKWHKHRPQVQIHQRCVHLRGGEMMDGKCSEQFLFIC 264
               ..::|.:..||.|...:|...  ..|..:..|:...|.|:..:.|||
Zfish    84 ---HWSSGDSVLFLNWASGQPYSS--DNCAVMINGKWFVGACTATWTFIC 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 24/109 (22%)
si:ch211-63p21.3XP_068078914.1 CLECT_1 23..130 CDD:153072 27/115 (23%)
CLECT 135..247 CDD:470576
CLECT 262..374 CDD:153057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.