DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and zgc:194252

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001122180.1 Gene:zgc:194252 / 561367 ZFINID:ZDB-GENE-081022-86 Length:251 Species:Danio rerio


Alignment Length:122 Identity:30/122 - (24%)
Similarity:51/122 - (41%) Gaps:25/122 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 HFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTE--LKDINDGSHDFWLDI-NDIAKW 213
            |||:.|  .:.|..|...|.:....|.|:.|:| |:|:.:.  :|:     ..||:.: |:..:|
Zfish    24 HFFVNK--TLSWQDAQKYCRQNYDDLSTVGSKD-LEALSSNPLIKE-----DYFWIGLQNNRNQW 80

  Fly   214 GEFISLATGMNPPFLKWHKHRPQVQIHQRCVHLRGG------EMMDGKCSEQFLFIC 264
                ..:||.......|.|..|.:.:...|    ||      :..:..|::|..|.|
Zfish    81 ----IWSTGEEARVTFWDKGEPTILLGGNC----GGVNKNTFKASNIGCNDQLHFYC 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 26/116 (22%)
zgc:194252NP_001122180.1 CLECT 22..131 CDD:295302 30/122 (25%)
CLECT 128..244 CDD:214480 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.