DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and illr4

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001035129.1 Gene:illr4 / 559737 ZFINID:ZDB-GENE-050311-5 Length:259 Species:Danio rerio


Alignment Length:206 Identity:46/206 - (22%)
Similarity:86/206 - (41%) Gaps:42/206 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 EKETNDKIKVIHDNVDNEFNALSAKIKNVKNIQRHLASLELQLQETKKALNLSVEAKKVMPKTEI 141
            :|:..| ::.:||.:...|.|.||.::::.|.:::|:          :|||.|.:.         
Zfish    74 QKKLQD-LQEVHDALQENFTAFSAVLEHIYNREQNLS----------RALNNSAQC--------- 118

  Fly   142 PSQFQ-KIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDFWL 205
            |..:| ..|..::|....:.:||||:...|...|.||:.|.:.||.:.:   :...|.....||:
Zfish   119 PEDWQYHAGKCYYFSSNTNTLDWFKSRDACISDGGHLVIINNRDEQEFL---MSKTNKYKGSFWI 180

  Fly   206 DINDIAKWGEFI-----SLAT------GMNPPFLKWHKHRPQVQIHQRCVHLRG-----GEMMDG 254
            .:.|.:..|:::     .|:|      |..|.  .|..:|.:....:.|..:..     ....|.
Zfish   181 GLTDKSTEGQWLWVDNTKLSTDIRYWNGQEPD--NWKGYRNEYTEGEDCARIEQNNWNINSWFDA 243

  Fly   255 KCSEQFLFICQ 265
            .|:..|..||:
Zfish   244 FCTIAFRRICE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 27/122 (22%)
illr4NP_001035129.1 CLECT_DC-SIGN_like 118..255 CDD:153060 32/151 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.