DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and colec12

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_005163514.1 Gene:colec12 / 558942 ZFINID:ZDB-GENE-030131-9807 Length:740 Species:Danio rerio


Alignment Length:138 Identity:33/138 - (23%)
Similarity:56/138 - (40%) Gaps:26/138 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 PSQFQKIGWR---HFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDF 203
            |.|::  |:|   :.|......:::.:|...|..:.:.:|.|..|:|...|:.::    .|...|
Zfish   605 PPQWK--GFREQCYHFSAPMESLNFDEAKERCSNLSSSMLIINDEEEQLWIKRQI----SGKGYF 663

  Fly   204 WLDINDIA-----KWGEFISLATGMNPPFLKWHKHRPQVQIH-----QRCVHL-RGGEMMDGKCS 257
            ||.:.|.|     :|      ..|..|.:.||...:|....|     :.|..| ......|..|:
Zfish   664 WLGLTDSAEENIWRW------VDGSLPNYTKWKPGQPDNWSHGHEAGEDCAGLIHEASWNDFFCT 722

  Fly   258 EQFLFICQ 265
            |:..|||:
Zfish   723 ERIGFICE 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 27/117 (23%)
colec12XP_005163514.1 RILP-like 145..267 CDD:304877
Collagen 468..551 CDD:189968
CLECT_DC-SIGN_like 608..731 CDD:153060 31/135 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.