DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and lectin-24Db

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster


Alignment Length:366 Identity:93/366 - (25%)
Similarity:140/366 - (38%) Gaps:113/366 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFQHANFFLHVFMACGLYGIRA------KDVC-----PRMSTDKEVCLVELAPVLKYISNNHKSH 54
            ||:.....:::.:||.|...||      :.||     |...  .|.||..|.|:|.:|. .|:..
  Fly     1 MFRLEKCIVYLLVACNLVESRAESTENSRSVCLLKDPPNQC--GEFCLSVLQPLLDHIV-KHQEQ 62

  Fly    55 WNSANEVQVNET-------RKQLA-----------KIEGQEKETNDKI----------------- 84
            ||::..:.:|||       :.|||           |:.|..|:..|::                 
  Fly    63 WNTSEALWLNETQGKLDRIQTQLAAQALSLEESAQKVPGDIKDRLDRMEHLQTTLQESLKKMPAE 127

  Fly    85 ------------KVIHDNVDNEFNALSAK-------IKNVK--NIQRHLASLELQ---LQETKKA 125
                        |.:.|.::|:.|.....       :||..  |.:..||.:|.|   ||||.|.
  Fly   128 LDARLMKMENQQKTLGDQLENQINLTKESQQDQLEALKNAMPINFEMRLAQIEEQQKLLQETLKK 192

  Fly   126 LNLSVE---------------------------AKKVMPKTEIPSQFQKIGWRHFFIEKKHKVDW 163
            :....|                           .|::..|...| :|::||.|.|:|..|...||
  Fly   193 IPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWP-KFERIGSRLFYINHKDAYDW 256

  Fly   164 FKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLDINDIAKWGEFISLATGMNPPFL 228
            ..|...|..||.::..|:.::|||||...|.|     ..:||.|||:.....::|:|:|....||
  Fly   257 QSAVDFCRDMGGYIAAIKDQEELDAISARLDD-----KSYWLGINDLQSSNTYVSVASGREVEFL 316

  Fly   229 KWHKHRPQVQIH----QRCVHLRGGEMMDGKCSEQFLFICQ 265
            .|:...|.   |    :.||.|...:|.|..|..:...|||
  Fly   317 NWNAGEPN---HGNEDENCVELIRSKMNDDPCHRKKHVICQ 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 35/110 (32%)
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 23/112 (21%)
NAT_SF <170..>229 CDD:302625 12/58 (21%)
CLECT 247..354 CDD:153057 36/114 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4072
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.