DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and lectin-29Ca

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster


Alignment Length:272 Identity:76/272 - (27%)
Similarity:122/272 - (44%) Gaps:48/272 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFQHANFFLHVFMACGLYGIRAKDVCPRMSTDKEVCLVELAPVLKYISNN---HKSHWNSANEVQ 62
            |:::|.....:|.....:|:.||    :..|......:..||:..|...|   |:.||.:.|.::
  Fly     1 MYKYATCIFSIFALWNFWGVSAK----KQDTSTGTNELPKAPMPYYTIENIDMHQQHWFTYNSLR 61

  Fly    63 VNETRKQLAKIEGQEKETNDKIKVIHDNVDNEFNALSAKIKNVKNIQRHLASLELQLQETKKALN 127
            .|.|..::..:|                     ..|..::::.:|      .:|.:|:..|:.:.
  Fly    62 QNGTLWRIGNME---------------------QRLEMRLQSFQN------QMETKLRALKQQIE 99

  Fly   128 LSVEAKKVMPKTEIPSQFQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTE 192
            ..:|..|:..|.:: |.|:|||.|||::||:.|:.|..|...|.:||.||..|..|.||:.|.:|
  Fly   100 PYMENVKMSNKIKM-SVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEIFSE 163

  Fly   193 LKDINDGSHDFWLDI----NDIAKWGEFISLATGMNPPFLKWHKHRPQVQIHQRCVHLRGGEMMD 253
                 :....:|:||    ||.|.|   ||..:|.:.||||| |......||..||::...||..
  Fly   164 -----ETKKKYWVDINSRANDGASW---ISTLSGRDVPFLKW-KPNLATNIHNHCVYINSNEMYF 219

  Fly   254 GKCSEQFLFICQ 265
            ..|:....|.||
  Fly   220 ENCANDNYFACQ 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 38/110 (35%)
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 38/108 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448755
Domainoid 1 1.000 45 1.000 Domainoid score I12161
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
98.900

Return to query results.
Submit another query.