DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and lectin-24A

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster


Alignment Length:294 Identity:79/294 - (26%)
Similarity:139/294 - (47%) Gaps:62/294 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 HVFMACGLYGIRAKDVCPRMSTDKEVCLVELAPVLKYISNNHKSHWNSANEVQVNETRK------ 68
            |.|.|    |....::.|..:.....|...|.||::|:: .|:..||:..|:..||.||      
  Fly    16 HEFSA----GTAKIEIQPLPALCNGYCFPTLKPVMEYVA-IHQDKWNTCTEILANEARKDQIQLN 75

  Fly    69 --------QLAKIEGQEKETNDKIKVIHDNVDNEFNALSAKIKNVKNIQRHLASLELQLQETKKA 125
                    .::.|:..:...::|:    |.::.|..|:.   ::::.|.|:|.   ::|..||  
  Fly    76 IQLDALKADVSNIKASQLSKDEKL----DRMEREQFAMH---ESLETINRYLT---VKLDRTK-- 128

  Fly   126 LNLSVEA-KKVMP--KTEIPSQ-------------FQKIGWRHFFIEKKHKVDWFKATSMCHKMG 174
              |.:|| |..|.  |.::...             |:|||.|:|:||:..:::|..|.:.|.:||
  Fly   129 --LQLEAIKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMG 191

  Fly   175 AHLLTIQSEDELDAIRTELKDINDGSHDFWLDINDIAKWGEFISLATGMNPPFLKW-----HKHR 234
            .||.:|:::.|.|||..:|    |.|..::|.:|:..|.|:|:|.|:|.:..:.:|     |.:.
  Fly   192 GHLASIKTKQEFDAIVEKL----DDSKSYFLGVNENTKTGDFVSAASGKSCLYHEWGPGEPHHNN 252

  Fly   235 PQVQIHQRCVHLRGGEMMDGKCSEQFLFICQLAV 268
            .|    :|||.:....|..|.|:.:..||||..:
  Fly   253 DQ----ERCVSILRKLMHVGNCTYEKRFICQYGI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 34/111 (31%)
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 38/118 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448765
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
109.900

Return to query results.
Submit another query.