DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and lectin-30A

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_652635.2 Gene:lectin-30A / 53541 FlyBaseID:FBgn0040097 Length:223 Species:Drosophila melanogaster


Alignment Length:232 Identity:68/232 - (29%)
Similarity:116/232 - (50%) Gaps:21/232 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VCLVELAPVLKYISNNHKSHWNSANEVQVNETRKQLAKIEGQEKETNDKIKVIHDNVDNEFNALS 99
            :|:: ||...:.:..|...:....::|.:|: ::....|..:|.|...||..|..:::....|:.
  Fly     7 ICVI-LAWASRDVLANKTENPLLIDQVAINQ-QQWFTFIALKESEMQQKIVRIERSIEERLMAMQ 69

  Fly   100 AKIKNVKN-IQRHLASLELQLQETKKALNLSVEAKKVMPKTEIPSQFQKIGWRHFFIEKKHKVDW 163
            :|:....| :|..:.:   |..||.:.|.:|....        |:.||::|.|.|:|||::|.:|
  Fly    70 SKLAYALNELQTIMGN---QSVETLEKLRISHRIN--------PALFQRMGTRRFYIEKENKQNW 123

  Fly   164 FKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLDINDIAKWGEFISLATGMNPPFL 228
            |.|::.|.::|.|:.||:.|.|.:.|.:...     :..||:|:|.:.|.|.|.|..||.:|||.
  Fly   124 FGASNTCRQLGGHIATIRDEQEFNEIFSRAP-----AGVFWIDMNAMFKNGLFASSLTGRSPPFF 183

  Fly   229 KWHKHRPQVQIHQRCVHLRGGEMMDGKCSEQFLFICQ 265
            ||.|.....:..  ||::...||.:..|....|||||
  Fly   184 KWKKEERGNKFD--CVNVYNKEMYNENCFNTHLFICQ 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 36/106 (34%)
lectin-30ANP_652635.2 CLECT 118..218 CDD:153057 36/106 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448753
Domainoid 1 1.000 45 1.000 Domainoid score I12161
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
87.800

Return to query results.
Submit another query.