DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and lectin-46Ca

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster


Alignment Length:129 Identity:30/129 - (23%)
Similarity:60/129 - (46%) Gaps:14/129 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 QKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLDINDI 210
            :::..:.|::..| |::||.|.:.|.:.|.:|..:.:.::..|: ........|..|||...||:
  Fly    38 RELNGKCFYVGIK-KINWFGAQNNCLRKGLNLADVSTMEDFKAV-VHYVTSQVGFDDFWFGGNDL 100

  Fly   211 AKWGEFISLATGMNPPFLKWHKHRPQVQIHQR-----CVHLR----GGEMMDGKCSEQFLFICQ 265
            ...|.|..:::|   ..:::......|:..||     |:.:|    ...::|..|.|:..|||:
  Fly   101 QSEGRFKYISSG---KLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVVLDVNCQEKKYFICE 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 28/115 (24%)
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 30/124 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.