DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and Clec4f

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_058031.2 Gene:Clec4f / 51811 MGIID:1859834 Length:548 Species:Mus musculus


Alignment Length:247 Identity:57/247 - (23%)
Similarity:110/247 - (44%) Gaps:56/247 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SHWNSANEVQVNETRKQLAKIEGQEKETNDKIKVIHDNVDNEFNALSAKIKNVK-NIQR---HLA 113
            |..||..||           :.||.|:.:.:::.:..:: ::.:||.:.::.:: |:||   .:.
Mouse   313 SSLNSRIEV-----------VNGQMKDASRELQTLRRDL-SDVSALKSNVQMLQSNLQRAKTEMQ 365

  Fly   114 SLELQLQETKK-------------ALNLSVEAKKVMPKTEIPSQFQKI---GWRH----FFIEKK 158
            ||:..||.||.             ||..:|.|:|...||:  :|..::   .|::    |:...:
Mouse   366 SLKADLQATKALTAKIQGEQNRLGALQEAVAAQKQEQKTQ--NQVLQLIAQNWKYFNGNFYYFSR 428

  Fly   159 HKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLDIND-----IAKWGEFIS 218
            .|..|.:|...|...||||.::.|::|...:   ::..:.|.|  |:.:.|     |.:|.:...
Mouse   429 DKKPWREAEKFCTSQGAHLASVTSQEEQAFL---VQTTSSGDH--WIGLTDQGTEGIWRWVDGTP 488

  Fly   219 LATGMNPPFLKWHKHRPQVQIHQR-----CVHLRGGEMMDGKCSEQFLFICQ 265
            .....:..|  |.|::|....|:.     |||:| .:..|..|...:.::|:
Mouse   489 FNNAQSKGF--WGKNQPDNWRHRNGEREDCVHVR-QQWNDMACGSSYPWVCK 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 27/116 (23%)
Clec4fNP_058031.2 PhageMin_Tail 144..411 CDD:304511 27/111 (24%)
MscS_porin 222..415 CDD:289559 27/115 (23%)
CLECT_DC-SIGN_like 414..538 CDD:153060 30/132 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.