DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and CD207

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_056532.4 Gene:CD207 / 50489 HGNCID:17935 Length:328 Species:Homo sapiens


Alignment Length:227 Identity:50/227 - (22%)
Similarity:101/227 - (44%) Gaps:42/227 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VNET----RKQLAKIEGQEKETNDKIKVIHDNVDNEFNALSAKIKNVKNIQRHLASLELQLQETK 123
            |||:    |.|..|::...::.|.:|:::..:.: |.:.|:|:|..:|:.....::|..:::..:
Human   112 VNESLGYVRSQFLKLKTSVEKANAQIQILTRSWE-EVSTLNAQIPELKSDLEKASALNTKIRALQ 175

  Fly   124 KAL-NLSVEAKKVMPKTEIPSQFQKIGWRHF--------FIEKKHKVDWFKATSMCHKMGAHLLT 179
            .:| |:|...|:.....::.||    ||::|        .|.|    .|:.|...|....:||.:
Human   176 GSLENMSKLLKRQNDILQVVSQ----GWKYFKGNFYYFSLIPK----TWYSAEQFCVSRNSHLTS 232

  Fly   180 IQSEDELDAI-RTELKDINDGSHDFWLDINDIAKWGEFISLATGMNPPFLK------WHKHRP-Q 236
            :.||.|.:.: :|.      |...:|:.:......|::..:.   :.||.|      |....| .
Human   233 VTSESEQEFLYKTA------GGLIYWIGLTKAGMEGDWSWVD---DTPFNKVQSVRFWIPGEPNN 288

  Fly   237 VQIHQRCVHLRGGEMM---DGKCSEQFLFICQ 265
            ...::.|.:::...:.   |..|.:.|||||:
Human   289 AGNNEHCGNIKAPSLQAWNDAPCDKTFLFICK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 24/117 (21%)
CD207NP_056532.4 CLECT_DC-SIGN_like 196..321 CDD:153060 32/142 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.