DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and Clec3a

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001007224.1 Gene:Clec3a / 403395 MGIID:2685642 Length:196 Species:Mus musculus


Alignment Length:194 Identity:45/194 - (23%)
Similarity:82/194 - (42%) Gaps:32/194 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 KETNDKIKVIHDNVDNEFNALSAKIKNVKNIQRHLASLELQLQETKKALNLSVEAKKVMPKTEIP 142
            |.:..::|...|::.::...|..::..:|         |:|..:|     :.:...||..|..:.
Mouse    31 KHSKRRVKAKDDDLKSQVEKLWREVNALK---------EMQALQT-----VCLRGTKVHKKCYLA 81

  Fly   143 SQFQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLDI 207
            |:    |.:|:          .:|...|...|..|:..::.||::|:|...|....|.:||||.|
Mouse    82 SE----GLKHY----------HEANEDCISKGGTLVVPRNSDEINALRDYGKRSLPGVNDFWLGI 132

  Fly   208 NDIAKWGEFISLATGMNPPFLKWHKHRPQVQIHQRCV---HLRGGEMMDGKCSEQFLFICQLAV 268
            ||:...|:|:.: .|....||.|.:.:|.....:.||   ....|:..|..|.....:||:..:
Mouse   133 NDMVTEGKFLDV-HGFAVSFLNWDRAQPSGGKRENCVLFSQSAQGKWSDEACRSSKRYICEFII 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 30/109 (28%)
Clec3aNP_001007224.1 CLECT_tetranectin_like 68..193 CDD:153066 37/139 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I5445
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4956
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.990

Return to query results.
Submit another query.