DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and Clec4b2

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001004159.1 Gene:Clec4b2 / 381809 MGIID:3588267 Length:208 Species:Mus musculus


Alignment Length:133 Identity:34/133 - (25%)
Similarity:59/133 - (44%) Gaps:17/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 PSQFQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLD 206
            |..::..|...:|.....:....|:...|...||||:.|.|::|.|.| |.:.|...|   :::.
Mouse    80 PKDWKPFGSYCYFTSTDSRASQNKSEEKCSLRGAHLVVIHSQEEQDFI-TRMLDTAAG---YFIG 140

  Fly   207 INDIA----KWGEFISLATGMNPPFLKWHKHRPQVQIHQRCVHLRGGEMM----DGKCSEQFLFI 263
            ::|:.    :|.:    .|..|.....|||..|. ..:::||.|...:.|    |..||::...:
Mouse   141 LSDVGNSQWRWID----QTPYNDRATFWHKGEPN-NDYEKCVILNYRKTMWGWNDIDCSDEENSV 200

  Fly   264 CQL 266
            ||:
Mouse   201 CQM 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 29/114 (25%)
Clec4b2NP_001004159.1 CLECT_DC-SIGN_like 79..203 CDD:153060 33/131 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.