DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and Clec4d

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001003707.1 Gene:Clec4d / 362432 RGDID:1303339 Length:218 Species:Rattus norvegicus


Alignment Length:127 Identity:31/127 - (24%)
Similarity:52/127 - (40%) Gaps:11/127 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 IGWRHF----FIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLDIN 208
            :.||.|    :........|.::...|..|.:||:||.:|.|.|.: |:|.| ...|:...|...
  Rat    84 VSWRAFQSNCYFALNDNQTWHESERNCSGMSSHLVTINTEAEQDFV-TQLLD-EQFSYFLGLSYE 146

  Fly   209 DIAKWGEFISLATGMNPPFLKWHKHRPQVQIHQRCVHLRGGE----MMDGKCSEQFLFICQL 266
            .:....:::. .|..||..:.|....|:..:.:.||.|...:    ..|..|..:...||:|
  Rat   147 KVEGQWQWVD-KTPFNPNVVFWKVGEPKDSMEEDCVVLVYDQDKWVWNDFPCHFEMGRICKL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 26/110 (24%)
Clec4dNP_001003707.1 CLECT_DC-SIGN_like 82..206 CDD:153060 29/124 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.