DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and CG11211

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster


Alignment Length:142 Identity:30/142 - (21%)
Similarity:64/142 - (45%) Gaps:20/142 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 KKVMPKTEIPSQFQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDIN 197
            :|..|..:..:.|...|:.        :|:|.:|..:|:::||.|.|:::|::...:   |..:|
  Fly    30 QKCNPLLQCNAYFSVAGFA--------EVNWLEANHVCNRVGAVLATVRNEEQHQLM---LHYVN 83

  Fly   198 D-----GSHDFWLDINDIAKWGEFIS-LATGMNPPFLKWHKHRPQVQI--HQRCVHLRGGEMMDG 254
            .     |:..|||...::.....|.: ::||:...:.:|.:..|:...  ...|:.|....:...
  Fly    84 RKERIFGNRTFWLGATNLVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHS 148

  Fly   255 K-CSEQFLFICQ 265
            : |..:..|||:
  Fly   149 EPCQRKHNFICE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 25/115 (22%)
CG11211NP_610208.1 CLECT 49..160 CDD:153057 25/113 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448844
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.