DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and Acp29AB

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster


Alignment Length:217 Identity:66/217 - (30%)
Similarity:103/217 - (47%) Gaps:37/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 HKSHWNSANEVQVNETRKQLAKIEGQEKETNDKIKVIHDNVDNEFNA-LSAKIKNVKNIQRHLAS 114
            ::::|.:.|.::.|||   ||.|:..|......:.        ||.| :..:::.:|.|.||.||
  Fly    48 NQNYWFTYNALKQNET---LAIIDTMEMRIASSLL--------EFKAQMEIQLQPLKIIMRHHAS 101

  Fly   115 LELQLQETKKALNLSVEAKKVMPKTEIPSQFQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLT 179
                  ..|.:.|:.:.            :|:|:|.|||.|||.....||:|...|.||..||..
  Fly   102 ------NIKASNNIKMR------------RFEKVGSRHFHIEKNLMQTWFEAYVTCRKMNGHLAN 148

  Fly   180 IQSEDELDAIRTELKDINDGSHDFWLDINDIAK-WGEFISLATGMNPPFLKWHKHRPQVQIHQRC 243
            ||.|.|||.|.....     ::.:|:||:.:.: .|.|:|..||..|.|:|| |.....:...:|
  Fly   149 IQDEMELDGILALAP-----NNSYWIDISKLVENGGTFVSTLTGREPFFVKW-KSNQDTKKKNQC 207

  Fly   244 VHLRGGEMMDGKCSEQFLFICQ 265
            |::...||...:|.|:..|:||
  Fly   208 VYIYAKEMSYDECFEKKSFVCQ 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 35/107 (33%)
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 40/113 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448754
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112956at50557
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
76.800

Return to query results.
Submit another query.