DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and lectin-37Db

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001014490.1 Gene:lectin-37Db / 3346221 FlyBaseID:FBgn0053533 Length:150 Species:Drosophila melanogaster


Alignment Length:125 Identity:42/125 - (33%)
Similarity:66/125 - (52%) Gaps:10/125 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 KIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLDINDIA 211
            :||.:.::|... |.:||:|::.|.:.|..||.::|.:||:.:...|..    ::.:||.|||:.
  Fly    30 EIGEKQYYISLA-KTNWFEASNHCRQNGGFLLNLESREELELLSPHLHP----AYSYWLSINDLG 89

  Fly   212 KWGEFISLATGMNPPFLKWHKHRPQVQI-HQRCVHL----RGGEMMDGKCSEQFLFICQL 266
            :.|.::|.|||:..|||.|....|.... :.|||.|    ...:|.|..|.....|||||
  Fly    90 ERGVYVSEATGLEAPFLNWSAGEPDNSSGYDRCVELWLSTTSFQMNDLPCYSSVAFICQL 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 36/111 (32%)
lectin-37DbNP_001014490.1 CLECT 34..148 CDD:153057 37/118 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12161
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.